Release 3.2. v3.2
authorSoren Stoutner <soren@stoutner.com>
Sat, 20 Jul 2019 18:03:28 +0000 (11:03 -0700)
committerSoren Stoutner <soren@stoutner.com>
Sat, 20 Jul 2019 18:03:28 +0000 (11:03 -0700)
29 files changed:
app/build.gradle
app/src/main/assets/blocklists/easylist.txt
app/src/main/assets/blocklists/easyprivacy.txt
app/src/main/assets/blocklists/fanboy-annoyance.txt
app/src/main/assets/blocklists/fanboy-social.txt
app/src/main/assets/de/about_changelog_dark.html
app/src/main/assets/de/about_changelog_light.html
app/src/main/assets/en/about_changelog_dark.html
app/src/main/assets/en/about_changelog_light.html
app/src/main/assets/es/about_changelog_dark.html
app/src/main/assets/es/about_changelog_light.html
app/src/main/assets/it/about_changelog_dark.html
app/src/main/assets/it/about_changelog_light.html
app/src/main/assets/ru/about_changelog_dark.html
app/src/main/assets/ru/about_changelog_light.html
app/src/main/assets/tr/about_changelog_dark.html
app/src/main/assets/tr/about_changelog_light.html
app/src/main/res/values/strings.xml
fastlane/metadata/android/de-DE/changelogs/46.txt [new file with mode: 0644]
fastlane/metadata/android/de-DE/images/phoneScreenshots/01-Homepage.png
fastlane/metadata/android/en-US/changelogs/46.txt [new file with mode: 0644]
fastlane/metadata/android/en-US/images/phoneScreenshots/01-Homepage.png
fastlane/metadata/android/es-ES/changelogs/46.txt [new file with mode: 0644]
fastlane/metadata/android/es-ES/images/phoneScreenshots/01-Homepage.png
fastlane/metadata/android/it-IT/changelogs/46.txt [new file with mode: 0644]
fastlane/metadata/android/it-IT/images/phoneScreenshots/01-Homepage.png
fastlane/metadata/android/ru-RU/changelogs/46.txt [new file with mode: 0644]
fastlane/metadata/android/ru-RU/images/phoneScreenshots/01-Homepage.png
fastlane/metadata/android/tr-TR/images/phoneScreenshots/01-Homepage.png

index 3b8c832a71d94387ae7afcc59c86314ba66a8b5b..c2562fe9f6994df8f97e95765875d6936984203c 100644 (file)
@@ -26,8 +26,8 @@ android {
     defaultConfig {
         minSdkVersion 19
         targetSdkVersion 28
-        versionCode 45
-        versionName "3.1"
+        versionCode 46
+        versionName "3.2"
     }
 
     buildTypes {
@@ -62,11 +62,6 @@ android {
         sourceCompatibility JavaVersion.VERSION_1_8
         targetCompatibility JavaVersion.VERSION_1_8
     }
-
-    // Allow the releases to be built even though the versions of the support and consent libraries don't match (Privacy Browser doesn't use the consent library form, so it doesn't matter).
-    lintOptions {
-        abortOnError false
-    }
 }
 
 dependencies {
@@ -86,5 +81,5 @@ dependencies {
     implementation 'com.google.android.material:material:1.0.0'
 
     // Only compile Firebase ads for the free flavor.
-    freeImplementation 'com.google.firebase:firebase-ads:18.0.0'
+    freeImplementation 'com.google.firebase:firebase-ads:18.1.0'
 }
\ No newline at end of file
index d0821ec5a286870bbc85e25fd06cd3113352345a..eebb6ac534b3fa69e8a093ebd79c15c85b188a76 100644 (file)
@@ -1,7 +1,7 @@
 [Adblock Plus 2.0]
-! Version: 201905232200
+! Version: 201907200204
 ! Title: EasyList
-! Last modified: 23 May 2019 22:00 UTC
+! Last modified: 20 Jul 2019 02:04 UTC
 ! Expires: 4 days (update frequency)
 ! Homepage: https://easylist.to/
 ! Licence: https://easylist.to/pages/licence.html
@@ -27,6 +27,7 @@
 &ad_number=
 &ad_revenue=
 &ad_slot=
+&ad_sub=
 &ad_time=
 &ad_type=
 &ad_type_
 -article-ad.
 -article-ads-
 -article-advert-
+-assets/ads.
 -auto-ads-
 -banner-768.
 -banner-ad-
 .php?adsid=
 .php?adv=
 .php?adv_
-.php?affid=
+.php?affid=$domain=~cancun-discounts.com
 .php?clicktag=
 .php?id=ads_
 .php?nats=
 /ad_announce.
 /ad_area.
 /ad_art/*
+/ad_article_
 /Ad_Arub_
 /ad_axt_
 /ad_banner.
 /ad_choices.
 /ad_choices_
 /ad_code.
+/ad_common.
 /ad_commonside.
 /ad_commonside_
 /ad_companion?
 /ad_count.
 /ad_counter.
 /ad_counter_
+/ad_create.
 /ad_creatives.
 /ad_data/*
 /ad_data_
 /adblockl.
 /adblockr.
 /adbn?
-/adboost.$domain=~adboost.io|~adboost.se|~adboost.sellerboost.de
+/adboost.$domain=~adboost.fr|~adboost.io|~adboost.se|~adboost.sellerboost.de
 /adborder.
 /adbot160.
 /adbot300.
 /aderlee_ads.
 /adError/*
 /adevent.$domain=~adevent.com
-/adevents.$domain=~adevents.com.au
+/adevents.$domain=~adevents.com|~adevents.com.au
 /adexample?
 /adexclude/*
 /adexternal.
 /adforgame728x90.
 /adforgame728x90_
 /adforge.
+/adform/Adform_
 /AdForm_trackpoint.
 /AdForm_trackpoint_
 /adformats/*
 /adfuncs.
 /adfunction.
 /adfunctions.
+/adfusion/*
 /adgallery1.
 /adgallery1|
 /adgallery2.
 /adkingpro-
 /adkingpro/*
 /adl.php
-/adlabel.
+/adlabel.$domain=~adlabel.adgoal.de
 /adlabel_
 /adlabs.js
 /AdLanding.
 /adleftsidebar.
 /adlens-
 /adlesse.
-/adlib.$domain=~adlib.info|~adlib.mu
+/adlib.$domain=~adlib.info|~adlib.mu|~catharijneconvent.nl
 /adlift4.
 /adlift4_
 /adline.$domain=~adline.co.il
 /admaxads.
 /admcoreext.
 /admeasure.
-/admedia.$domain=~admedia.co.il|~admedia.net.au
+/admedia.$domain=~admedia.co.il|~admedia.com|~admedia.net.au
 /admedia/*
 /admega.
 /admeld.
 /adoptimised.
 /AdOptimizer.
 /adoptionicon.
-/adoptions.
+/adoptions.$domain=~efollett.com
 /adorika300.
 /adorika728.
 /ados.js
 /adright.$domain=~adright.com
 /adright/*
 /adrightcol.
-/adriver.$~object-subrequest
+/adriver.$~object-subrequest,domain=~adriver.co
 /adriver/*
 /adriver_$~object-subrequest
 /adrobot.$domain=~adrobot.com.au
 /ads/ad-
 /ads/ad.
 /ads/ad_
+/ads/ado-
 /ads/adp4.
 /ads/adrime/*
 /Ads/adrp0.
 /ads/leaderbox.
 /ads/like/*
 /ads/load.
+/ads/lz_loader.
 /ads/main.
 /ads/marketing/*
 /ads/masthead_
 /ads9/*
 /ads?apid
 /ads?callback
+/ads?code=
 /ads?id=
 /ads?param=
 /ads?spaceid
 /advelvet-
 /advengine.
 /adver-left.
-/adver.$domain=~adver.biz|~adver.media
+/adver.$domain=~adver.biz|~adver.by|~adver.media
 /adver_hor.
 /adverfisement.
 /adverfisement2.
 /advertiserwidget.
 /advertises/*
 /advertisewithus_
-/advertising-$domain=~abramarketing.com|~advertising-direct.com|~advertising-factory.de|~microsoft.com|~outbrain.com|~yellowimages.com
+/advertising-$domain=~abramarketing.com|~advertising-direct.com|~advertising-excellence.com|~advertising-factory.de|~microsoft.com|~outbrain.com|~yellowimages.com
 /advertising.$domain=~advertising.amazon.ae|~advertising.amazon.ca|~advertising.amazon.cn|~advertising.amazon.co.jp|~advertising.amazon.co.uk|~advertising.amazon.com|~advertising.amazon.com.au|~advertising.amazon.com.mx|~advertising.amazon.de|~advertising.amazon.es|~advertising.amazon.fr|~advertising.amazon.in|~advertising.amazon.it|~advertising.amazon.sa|~advertising.berlin-airport.de|~advertising.bulurum.com|~advertising.byhoxby.com|~advertising.dailymotion.com|~advertising.expedia.com|~advertising.lavenir.net|~advertising.mobile.de|~advertising.org.il|~advertising.roku.com|~advertising.sevenwestmedia.com.au|~advertising.shpock.com|~advertising.theguardian.com
 /advertising/*$~xmlhttprequest,domain=~advertising.org.il|~commercialplanet.eu|~kloterfarms.com|~temple.edu|~themarker.com
 /advertising02.
 /advertright.
 /adverts.$domain=~adverts.ie|~adverts.org.ua
 /adverts/*
-/adverts/rules.
 /adverts_
 /advertserve.
 /advertsky.
 /Api/Ad.
 /api/ad/*
 /api/ads/*
+/api/v1/ad/*
 /apopwin.
 /app.ads-
 /app.ads.
 /app/ads.
 /app/ads/*
+/apstag.js
 /aptads/*
 /arcAdsJS/*
 /Article-Ad-
 /backlinxxx/js/*
 /badge_ad_
 /ban.php?
+/ban/image?
+/ban/json/*
 /ban160.php
 /ban300.html
 /ban300.php
 /breakad_
 /breaking_ad/*
 /brightcovead.
+/brokenAd.
 /brsAssets/ads/*
 /bsa-pro-
 /bserver/*
 /gawker/ads.
 /gazette/ads/*
 /geitonpop.
+/geminivideoads/*
 /gen-ad-
 /gen_ads_
 /genads/*
 /google_ads.
 /google_ads/*
 /google_ads_
+/google_adsense-
 /google_adv/*
 /google_afc.
 /google_afc_
 /mkadsrv.
 /mktad.
 /ml9pagepeel.
+/mmads-
+/mmads.
 /mmsAds.
 /mmt_ad.
 /mnads1.
 /n4403ad.
 /n_ads/*
 /na.ads.
+/nad_exo.
 /namediaad.
 /natad.
 /native-ad-
 /notifyad.
 /now/ads/*$~xmlhttprequest
 /nsfw/sponsors/*
+/ntAds-
 /nugg.min.js
 /nuggad.
 /nuggad/*
 /responsive-ad-
 /responsive-ad.
 /responsive-ads.
+/responsive/ad_
 /responsive_ads.
 /responsive_dfp.
 /responsive_dfp_
 /show-ads.
 /show.ad?
 /show.cgi?adp
+/show?zone_id=
 /show_ad.
 /show_ad?
 /show_ad_
 /videoad_new.
 /VideoAdContent?
 /videoadrenderer.
+/videoadroll.
 /videoads.
 /videoads/*
 /VideoAdsServingService/*
 /vpaidadrenderer.
 /vplayerad.
 /vrdinterads-
+/vsl/js/*
+/vsl/vst/*
 /vtextads.
 /VXLayerAd-
 /w/ads/*
 /widgetad.
 /widgetadsense.
 /widgets/ads.
-/widgets/adverts/*.
 /widgets/ms/*.php?
 /widgets/sponsored/*
 /wipeads/*
 ://a.ads.
 ://ad.*/jstag^
 ://adcl.$domain=~adcl.com
-://ads.$domain=~ads.ac.uk|~ads.adstream.com.ro|~ads.am|~ads.bigbom.com|~ads.colombiaonline.com|~ads.comeon.com|~ads.elcarado.com|~ads.google.com|~ads.harvard.edu|~ads.lapalingo.com|~ads.lordlucky.com|~ads.mobilebet.com|~ads.msstate.edu|~ads.nc|~ads.nimses.com|~ads.quasaraffiliates.com|~ads.red|~ads.route.cc|~ads.safi-gmbh.ch|~ads.sk|~ads.socialtheater.com|~ads.taboola.com|~ads.toplayaffiliates.com|~ads.viksaffiliates.com|~ads.watson.ch|~ads.xtribeapp.com|~ads.yahoosmallbusiness.com|~badassembly.com|~caravansforsale.co.uk|~fusac.fr|~memo2.nl|~reempresa.org|~seriouswheels.com
+://ads.$domain=~ads.ac.uk|~ads.adstream.com.ro|~ads.am|~ads.bigbom.com|~ads.brave.com|~ads.colombiaonline.com|~ads.comeon.com|~ads.elcarado.com|~ads.google.com|~ads.harvard.edu|~ads.lapalingo.com|~ads.lordlucky.com|~ads.mobilebet.com|~ads.msstate.edu|~ads.nc|~ads.nimses.com|~ads.quasaraffiliates.com|~ads.red|~ads.route.cc|~ads.safi-gmbh.ch|~ads.sk|~ads.socialtheater.com|~ads.taboola.com|~ads.toplayaffiliates.com|~ads.viksaffiliates.com|~ads.watson.ch|~ads.xtribeapp.com|~ads.yahoosmallbusiness.com|~badassembly.com|~caravansforsale.co.uk|~fusac.fr|~memo2.nl|~reempresa.org|~seriouswheels.com
 ://adv.$domain=~adv.bet|~adv.cincsys.com|~adv.co.it|~adv.cryptonetlabs.it|~adv.derfunke.at|~adv.ee|~adv.gg|~adv.michaelgat.com|~adv.msk.ru|~adv.ru|~adv.vg|~adv.works|~adv.yomiuri.co.jp|~advids.co|~erti.se|~escreverdireito.com|~farapp.com|~forex-tv-online.com|~r7.com|~typeform.com|~welaika.com
 ://affiliate.$third-party
 ://affiliates.$third-party
@@ -7967,18 +7991,21 @@ _prx/ba_$script
 -prebid.$script
 -prebid/
 .prebid.js
+/adn-hb/*
+/adn.ano.
 /ads/prebid_
 /anprebid/*
 /AudienceNetworkPrebid.
 /AudienceNetworkPrebidLite.
 /biddr-*.js
 /ext/prebid
+/gpt_and_prebid/*
 /jppolPrebid.
 /newPrebid.
 /pb.min.
 /pbjs-*.js
 /prebid-
-/prebid.$script,domain=~prebid.org
+/prebid.$domain=~prebid.org
 /prebid/*
 /prebid1.
 /prebid14.js
@@ -8045,7 +8072,7 @@ _prebid_
 ! Common adserver string
 /mediahosting.engine$document,script,subdocument
 /Redirect.a2b?$document,script,subdocument
-/sitetestclickcount.enginedocument,script,subdocument
+/sitetestclickcount.engine$document,script,subdocument
 /Tag.eng$document,script,subdocument
 /Tag.rb$document,script,subdocument
 ! White papers insert
@@ -8267,6 +8294,7 @@ _atblockdetector/
 /300x250px_
 /300x350.
 /300x600-
+/300x600_
 /300x90_
 /320x250.
 /335x205_
@@ -8703,6 +8731,7 @@ _a468x60.
 /?cver=0&refer$popup
 /?cver=1&refer$popup
 /?ip=*&zoneid=$popup
+/?pid=*&dn=$popup
 /?placement=*&redirect$popup
 /?pmxy=$popup
 /?r=*&zoneid=$popup
@@ -8734,6 +8763,7 @@ _a468x60.
 /adsys/*$popup
 /advlink.$popup
 /adx.php?source=$popup
+/aff/zbo.php?$popup
 /aff_ad?$popup
 /afu.php?$popup
 /apu.php?*&zoneid=$popup
@@ -8780,6 +8810,7 @@ _a468x60.
 /showads/*$popup
 /spopunder^$popup
 /srvclk.php?$popup
+/tr?id=*&tk=$popup
 /watch?*&refer=$popup
 /watch?key=$popup,third-party
 /watch?refer=$popup
@@ -8801,6 +8832,8 @@ _a468x60.
 ?xref=*&zoneid=$popup
 ?zoneid=*_bannerid=$popup
 _popunder+$popup
+! popupads
+=direct&siteId=*=http$popup
 ! Commonly used popup scripts on movie/tv streaming sites
 |javascript:*setTimeout$popup
 |javascript:*window.location$popup
@@ -9324,6 +9357,7 @@ _popunder+$popup
 ###Module-From_Advertisers
 ###MyAdHeader
 ###MyAdSky
+###MyAdsId
 ###NavAD
 ###Nightly_adContainer
 ###NormalAdModule
@@ -10107,6 +10141,7 @@ _popunder+$popup
 ###ad336atf
 ###ad336iiatf
 ###ad336x280
+###ad368_2578
 ###ad375x85
 ###ad3Article
 ###ad3small
@@ -10380,6 +10415,7 @@ _popunder+$popup
 ###adSide
 ###adSideButton
 ###adSidebar
+###adSidebarSpecial
 ###adSidebarSq
 ###adSite
 ###adSkin
@@ -10755,6 +10791,7 @@ _popunder+$popup
 ###ad_creative_5
 ###ad_crown_top
 ###ad_cyborg
+###ad_dfp_premiumrec
 ###ad_display_300_250
 ###ad_display_728_90
 ###ad_div
@@ -12050,6 +12087,7 @@ _popunder+$popup
 ###adunitl
 ###adv-01
 ###adv-300
+###adv-Scrollable
 ###adv-Top
 ###adv-box
 ###adv-comments-placeholder
@@ -12370,6 +12408,7 @@ _popunder+$popup
 ###advertisement_container
 ###advertisement_label
 ###advertisement_notice
+###advertisement_title
 ###advertisementblock1
 ###advertisementblock2
 ###advertisementblock3
@@ -13556,6 +13595,7 @@ _popunder+$popup
 ###custom-advert-leadboard-spacer
 ###custom-small-ad
 ###customAd
+###customAds
 ###cxnAdrail
 ###d-adCont543x90
 ###d-adCont728x90Inner
@@ -13595,6 +13635,7 @@ _popunder+$popup
 ###dcomad_top_300x250_0
 ###dcomad_top_300x250_1
 ###dcomad_top_300x251_2
+###dd-ad-head-wrapper
 ###ddAd
 ###ddAdZone2
 ###defer-adright
@@ -14788,6 +14829,8 @@ _popunder+$popup
 ###js-story__ad-storyrec
 ###js-wide-ad
 ###js_adsense
+###jsid-ad-container-post_above_comment
+###jsid-ad-container-post_below_comment
 ###jt-advert
 ###jupiter-ads
 ###ka_adFullBanner
@@ -15995,6 +16038,7 @@ _popunder+$popup
 ###side-content-ad-2
 ###side-halfpage-ad
 ###side-skyscraper-ad
+###side160x600banner
 ###sideABlock
 ###sideABlockHeader
 ###sideAD
@@ -16039,6 +16083,8 @@ _popunder+$popup
 ###sidebar-125x125-ads
 ###sidebar-125x125-ads-below-index
 ###sidebar-ad
+###sidebar-ad-1
+###sidebar-ad-2
 ###sidebar-ad-300
 ###sidebar-ad-block
 ###sidebar-ad-boxes
@@ -17186,6 +17232,7 @@ _popunder+$popup
 ##.AdLeftbarBorderStyle
 ##.AdMedium
 ##.AdMessage
+##.AdMod
 ##.AdModule
 ##.AdModule_Content
 ##.AdModule_ContentLarge
@@ -17553,6 +17600,7 @@ _popunder+$popup
 ##.Squareadspot
 ##.StandardAdLeft
 ##.StandardAdRight
+##.StickyAdRail__Inner
 ##.SummaryPage-HeaderAd
 ##.TOP-ADS
 ##.TRADING_AD_RELATED
@@ -17621,6 +17669,7 @@ _popunder+$popup
 ##.a-article-teaser--sponsored
 ##.a-d-container
 ##.a-d-rotate_widgets
+##.a-sponsor
 ##.a160x600
 ##.a300x250
 ##.a468x60
@@ -17874,6 +17923,8 @@ _popunder+$popup
 ##.ad-bg
 ##.ad-big
 ##.ad-big-box
+##.ad-bigbanner
+##.ad-bigbillboard
 ##.ad-bigbox
 ##.ad-bigbox-fixed
 ##.ad-bigboxSub
@@ -17993,6 +18044,7 @@ _popunder+$popup
 ##.ad-content-area
 ##.ad-content-rectangle
 ##.ad-context
+##.ad-cover
 ##.ad-curtain
 ##.ad-custom-size
 ##.ad-d
@@ -18098,6 +18150,7 @@ _popunder+$popup
 ##.ad-in-300x250
 ##.ad-in-content-300
 ##.ad-in-post
+##.ad-in-read
 ##.ad-in-results
 ##.ad-incontent-ad-plus-billboard-top
 ##.ad-incontent-ad-plus-bottom
@@ -18352,6 +18405,7 @@ _popunder+$popup
 ##.ad-showcase
 ##.ad-side
 ##.ad-side-one
+##.ad-side-top
 ##.ad-sidebar
 ##.ad-sidebar-180-150
 ##.ad-sidebar-300-250
@@ -18822,6 +18876,7 @@ _popunder+$popup
 ##.adBottomLink
 ##.adBottomboxright
 ##.adBox
+##.adBox-a
 ##.adBox-mr
 ##.adBox1
 ##.adBox2
@@ -19029,6 +19084,7 @@ _popunder+$popup
 ##.adRecommendRight
 ##.adRect
 ##.adRectangle
+##.adRectangleBanner
 ##.adRectangleUnit
 ##.adRegionSelector
 ##.adRemove
@@ -19058,6 +19114,7 @@ _popunder+$popup
 ##.adSidebarButtons
 ##.adSidetileplus
 ##.adSize_MedRec
+##.adSizer
 ##.adSkin
 ##.adSkinLayerConfig
 ##.adSky
@@ -19076,6 +19133,7 @@ _popunder+$popup
 ##.adSpace300x250
 ##.adSpace950x90
 ##.adSpacer
+##.adSpec
 ##.adSplash
 ##.adSponsor
 ##.adSponsorText
@@ -19258,6 +19316,7 @@ _popunder+$popup
 ##.ad__centered
 ##.ad__container
 ##.ad__content
+##.ad__desk
 ##.ad__in-loop
 ##.ad__in-loop--desktop
 ##.ad__inline
@@ -19528,6 +19587,7 @@ _popunder+$popup
 ##.ad_megabanner
 ##.ad_message
 ##.ad_microlen
+##.ad_mid_post_body
 ##.ad_middle
 ##.ad_middle_banner
 ##.ad_middle_hub_page
@@ -19628,6 +19688,7 @@ _popunder+$popup
 ##.ad_sidebar
 ##.ad_sidebar_bigbox
 ##.ad_size_160x600
+##.ad_skin
 ##.ad_sky
 ##.ad_skyscpr
 ##.ad_skyscraper
@@ -20771,6 +20832,7 @@ _popunder+$popup
 ##.adsense728
 ##.adsense728x90
 ##.adsenseAds
+##.adsenseBannerArea
 ##.adsenseBlock
 ##.adsenseContainer
 ##.adsenseGreenBox
@@ -21171,6 +21233,7 @@ _popunder+$popup
 ##.adv_160_600
 ##.adv_160x600
 ##.adv_2
+##.adv_250
 ##.adv_250_250
 ##.adv_300
 ##.adv_300_300
@@ -21528,6 +21591,8 @@ _popunder+$popup
 ##.advertisement-container
 ##.advertisement-content
 ##.advertisement-copy
+##.advertisement-custom-content
+##.advertisement-custom-post
 ##.advertisement-dashed
 ##.advertisement-header
 ##.advertisement-information-link
@@ -21611,6 +21676,7 @@ _popunder+$popup
 ##.advertisement_main_right_top_computer
 ##.advertisement_post
 ##.advertisement_river
+##.advertisement_section_top
 ##.advertisement_sky
 ##.advertisement_top
 ##.advertisement_watchFooter
@@ -21762,6 +21828,7 @@ _popunder+$popup
 ##.advtop
 ##.advtop-leaderbord
 ##.advttopleft
+##.advv_box
 ##.advword
 ##.adwert
 ##.adwhitespace
@@ -21996,6 +22063,7 @@ _popunder+$popup
 ##.aside_AD06
 ##.aside_AD08
 ##.aside_AD09
+##.aside_ad_large
 ##.aside_banner_ads
 ##.aside_google_ads
 ##.associated-ads
@@ -22082,6 +22150,7 @@ _popunder+$popup
 ##.banner-ad
 ##.banner-ad-300x250
 ##.banner-ad-b
+##.banner-ad-below
 ##.banner-ad-block
 ##.banner-ad-container
 ##.banner-ad-footer
@@ -22328,6 +22397,7 @@ _popunder+$popup
 ##.block-ads-eplanning-300x600
 ##.block-ads-home
 ##.block-ads-top
+##.block-ads-yahoo
 ##.block-ads1
 ##.block-ads2
 ##.block-ads3
@@ -22509,6 +22579,7 @@ _popunder+$popup
 ##.bottom-ads-wrapper
 ##.bottom-ads728
 ##.bottom-adv
+##.bottom-adv-container
 ##.bottom-banner-ad
 ##.bottom-center-adverts
 ##.bottom-game-ad
@@ -22960,6 +23031,7 @@ _popunder+$popup
 ##.colBoxAdframe
 ##.colRightAd
 ##.col_ad
+##.col_adunit300x250
 ##.col_header_ads_300x250
 ##.colads
 ##.collapse-ad-mob-wrapper
@@ -22998,6 +23070,7 @@ _popunder+$popup
 ##.confirm_ad_left
 ##.confirm_ad_right
 ##.confirm_leader_ad
+##.connatix-wrapper
 ##.consoleAd
 ##.cont-ad
 ##.contads_middle
@@ -23574,6 +23647,7 @@ _popunder+$popup
 ##.fixedAds
 ##.fixedRightAd
 ##.fixed_ad_336x280
+##.fixed_bottom_ad
 ##.fl-ads
 ##.fl-adsense
 ##.fl_adbox
@@ -23890,6 +23964,7 @@ _popunder+$popup
 ##.google-ad-fix
 ##.google-ad-iframe
 ##.google-ad-image
+##.google-ad-manager__slot
 ##.google-ad-pad
 ##.google-ad-placeholder
 ##.google-ad-side_ad
@@ -24069,6 +24144,7 @@ _popunder+$popup
 ##.grid-ad-section
 ##.grid-advertisement
 ##.grid-item-ad
+##.grid-sm-ad-300
 ##.gridAd
 ##.gridAdRow
 ##.gridSideAd
@@ -24496,6 +24572,7 @@ _popunder+$popup
 ##.inArticleAdInner
 ##.inPageAd
 ##.inStoryAd-news2
+##.in_ad
 ##.in_article_ad
 ##.in_content_ad_container
 ##.in_content_advert
@@ -24565,6 +24642,7 @@ _popunder+$popup
 ##.inlistAd
 ##.inner-ad
 ##.inner-ad-disclaimer
+##.inner-adv
 ##.inner-advt-banner-3
 ##.inner-post-ad
 ##.inner468ad
@@ -24645,6 +24723,7 @@ _popunder+$popup
 ##.itinerary-index-advertising
 ##.itw-ad
 ##.iw-leaderboard-ad
+##.j-ads-mrec
 ##.jLinkSponsored
 ##.j_ads
 ##.ja-ads
@@ -25002,6 +25081,8 @@ _popunder+$popup
 ##.m-ContentAd
 ##.m-ad
 ##.m-ad--open
+##.m-ad-region
+##.m-ad-region-leaderboard
 ##.m-ad-tvguide-box
 ##.m-advert
 ##.m-advertisement
@@ -25426,6 +25507,7 @@ _popunder+$popup
 ##.mvAd
 ##.mvAdHdr
 ##.mvp-ad-label
+##.mvp-feat1-list-ad
 ##.mvp-widget-ad
 ##.mvp-widget-feat2-side-ad
 ##.mvp_ad_widget
@@ -25481,6 +25563,7 @@ _popunder+$popup
 ##.nav_textads
 ##.navad
 ##.navadbox
+##.navbar-header-ad
 ##.navcommercial
 ##.navi_ad300
 ##.naviad
@@ -25496,6 +25579,7 @@ _popunder+$popup
 ##.nbc_ad_carousel_wrp
 ##.nc-dealsaver-container
 ##.nc-exp-ad
+##.nchadcont
 ##.nda-ad
 ##.nda-ad--leaderboard
 ##.ndmadkit
@@ -25536,6 +25620,7 @@ _popunder+$popup
 ##.nexusad
 ##.nf-adbox
 ##.ng-ad-banner
+##.ng-ad-container-300-250
 ##.ngs-adv-async
 ##.ninemsn-footer-ad
 ##.ninth-box-ad
@@ -25683,6 +25768,7 @@ _popunder+$popup
 ##.p-ad
 ##.p-ad-outbreak
 ##.p-ad-rectangle
+##.p-post-ad
 ##.p2_right_ad
 ##.p75_sidebar_ads
 ##.pAdsBlock2
@@ -25700,6 +25786,7 @@ _popunder+$popup
 ##.page-ads
 ##.page-advert
 ##.page-box-ad
+##.page-footer-ad
 ##.page-header-ad
 ##.page-pencil-ad-container-bottom
 ##.pageAdSkinUrl
@@ -26040,6 +26127,7 @@ _popunder+$popup
 ##.purchad
 ##.push--ad
 ##.push-ad
+##.push-adv
 ##.push-item--advertisement
 ##.pushDownAd
 ##.pushdown-ad
@@ -26442,6 +26530,7 @@ _popunder+$popup
 ##.sa-mainad
 ##.sa_AdAnnouncement
 ##.sadvert
+##.salty-bottom-ad
 ##.sam-ad
 ##.sam-pro-ad
 ##.sam-pro-container
@@ -26604,6 +26693,10 @@ _popunder+$popup
 ##.side-ad-container
 ##.side-ad-inner
 ##.side-ad-panel
+##.side-ad-top
+##.side-ad1
+##.side-ad2
+##.side-ad3
 ##.side-ads
 ##.side-ads-block
 ##.side-ads-container
@@ -26725,6 +26818,7 @@ _popunder+$popup
 ##.sidebar_ADBOX
 ##.sidebar__ad
 ##.sidebar__ad-label
+##.sidebar__item-spacer--advert-top
 ##.sidebar_ad
 ##.sidebar_ad_1
 ##.sidebar_ad_2
@@ -26759,6 +26853,7 @@ _popunder+$popup
 ##.sidebarads
 ##.sidebaradsense
 ##.sidebarboxad
+##.sidebox-ad
 ##.sideheadnarrowad
 ##.sideheadsponsorsad
 ##.sidelist_ad
@@ -27092,6 +27187,7 @@ _popunder+$popup
 ##.sponsored-text-links__ads
 ##.sponsored-title
 ##.sponsored-top
+##.sponsored-widget
 ##.sponsoredAd
 ##.sponsoredAdLine
 ##.sponsoredAds
@@ -27293,6 +27389,7 @@ _popunder+$popup
 ##.streamAd
 ##.strip-ad
 ##.stripad
+##.sub-ad
 ##.sub-feature-ad
 ##.sub-header-ad
 ##.subAdBannerArea
@@ -27316,6 +27413,7 @@ _popunder+$popup
 ##.sugarad
 ##.suit-ad-inject
 ##.suitcase-ad
+##.sun-col-2--is-ad
 ##.sunfw-pos-all_adv_728_90_nm
 ##.super-ad
 ##.super-leaderboard-advert
@@ -27351,7 +27449,6 @@ _popunder+$popup
 ##.tablet_ad_head
 ##.taboola-above-article-thumbnails
 ##.taboola-ad
-##.taboola-container
 ##.taboola-inbetweener
 ##.taboola-item
 ##.taboola-left-rail-wrapper
@@ -27581,6 +27678,7 @@ _popunder+$popup
 ##.top-adsense-banner
 ##.top-adspace
 ##.top-adv
+##.top-adv-container
 ##.top-adverbox
 ##.top-advert
 ##.top-advertisement
@@ -27646,6 +27744,7 @@ _popunder+$popup
 ##.topBannerAdSectionR
 ##.topBarAd
 ##.topBoxAdvertisement
+##.topGoogleAd
 ##.topHeaderLeaderADWrap
 ##.topLeaderboardAd
 ##.topNavRMAd
@@ -28313,6 +28412,10 @@ _popunder+$popup
 ##.ytp-ad-progress
 ##.ytp-ad-progress-list
 ##.yui3-ad
+##.yvp-ads-overlay
+##.yvp-ads-view
+##.yvp-adsview-show
+##.yvp-mode-ad
 ##.yw-ad
 ##.z-ad-display
 ##.z-ad-lockerdome-inline
@@ -28361,6 +28464,7 @@ _popunder+$popup
 ##a[href$="/vghd.shtml"]
 ##a[href*=".adk2x.com/"]
 ##a[href*=".adsrv.eacdn.com/"] > img
+##a[href*=".allsports4you.club"]
 ##a[href*=".approvallamp.club/"]
 ##a[href*=".bang.com/"][href*="&aff="]
 ##a[href*=".clkcln.com/"]
@@ -28373,7 +28477,6 @@ _popunder+$popup
 ##a[href*=".revimedia.com/"]
 ##a[href*="//3wr110.xyz/"]
 ##a[href*="//ridingintractable.com/"]
-##a[href*="//xml.revrtb.com/"]
 ##a[href*="/adServe/banners?"]
 ##a[href*="/adrotate-out.php?"]
 ##a[href*="/cmd.php?ad="]
@@ -28389,7 +28492,6 @@ _popunder+$popup
 ##a[href*="delivery.trafficfabrik.com"]
 ##a[href*="emprestimo.eu"]
 ##a[href*="googleme.eu"]
-##a[href*="letsadvertisetogether.com"]
 ##a[href*="mfroute.com/"]
 ##a[href*="onclkds."]
 ##a[href*="pussl3.com"]
@@ -28415,10 +28517,10 @@ _popunder+$popup
 ##a[href^="//look.djfiln.com/"]
 ##a[href^="//medleyads.com/spot/"]
 ##a[href^="//nlkdom.com/"]
+##a[href^="//oardilin.com/"]
 ##a[href^="//porngames.adult/?SID="]
+##a[href^="//pubads.g.doubleclick.net/"]
 ##a[href^="//srv.buysellads.com/"]
-##a[href^="//t.MtagMonetizationA.com/"]
-##a[href^="//tracking.content-recommendation.net/"][href*="/sponsored/click.html?"]
 ##a[href^="//voyeurhit.com/cs/"]
 ##a[href^="//www.mgid.com/"]
 ##a[href^="//www.pd-news.com/"]
@@ -28492,6 +28594,7 @@ _popunder+$popup
 ##a[href^="http://bestorican.com/"]
 ##a[href^="http://betahit.click/"]
 ##a[href^="http://bluehost.com/track/"]
+##a[href^="http://bodelen.com/"]
 ##a[href^="http://bonusfapturbo.nmvsite.com/"]
 ##a[href^="http://bs.serving-sys.com/"]
 ##a[href^="http://buysellads.com/"]
@@ -28674,7 +28777,6 @@ _popunder+$popup
 ##a[href^="http://www.TwinPlan.com/AF_"]
 ##a[href^="http://www.accuserveadsystem.com/accuserve-go.php?"]
 ##a[href^="http://www.adbrite.com/mb/commerce/purchase_form.php?"]
-##a[href^="http://www.adshost2.com/"]
 ##a[href^="http://www.adskeeper.co.uk/"]
 ##a[href^="http://www.adxpansion.com"]
 ##a[href^="http://www.afco2go.com/srv.php?"]
@@ -28785,6 +28887,7 @@ _popunder+$popup
 ##a[href^="https://ad.doubleclick.net/"]
 ##a[href^="https://adclick.g.doubleclick.net/"]
 ##a[href^="https://adhealers.com/"]
+##a[href^="https://ads-for-free.com/click.php?"]
 ##a[href^="https://ads.ad4game.com/"]
 ##a[href^="https://ads.trafficpoizon.com/"]
 ##a[href^="https://adserver.adreactor.com/"]
@@ -28794,7 +28897,9 @@ _popunder+$popup
 ##a[href^="https://atomidownload.com/"]
 ##a[href^="https://awejmp.com/"]
 ##a[href^="https://awentw.com/"]
+##a[href^="https://badoinkvr.com/"]
 ##a[href^="https://betway.com/"][href*="&a="]
+##a[href^="https://bnsjb1ab1e.com/"]
 ##a[href^="https://bongacams2.com/track?"]
 ##a[href^="https://bs.serving-sys.com"]
 ##a[href^="https://bullads.net/get/"]
@@ -28825,12 +28930,14 @@ _popunder+$popup
 ##a[href^="https://googleads.g.doubleclick.net/pcs/click"]
 ##a[href^="https://iac.ampxdirect.com/"]
 ##a[href^="https://iactrivago.ampxdirect.com/"]
+##a[href^="https://ilovemyfreedoms.com/"][href*="?affiliate_id="]
 ##a[href^="https://incisivetrk.cvtr.io/click?"]
 ##a[href^="https://intrev.co/"]
 ##a[href^="https://jmp.awempire.com/"]
 ##a[href^="https://keep2share.cc/pr/"]
 ##a[href^="https://land.brazzersnetwork.com/landing/"]
 ##a[href^="https://land.rk.com/landing/"]
+##a[href^="https://landing1.brazzersnetwork.com"]
 ##a[href^="https://lingthatsparleso.info/"]
 ##a[href^="https://m.do.co/c/"] > img
 ##a[href^="https://medleyads.com/"]
@@ -28838,6 +28945,7 @@ _popunder+$popup
 ##a[href^="https://mk-ads.com/"]
 ##a[href^="https://mk-cdn.net/"]
 ##a[href^="https://paid.outbrain.com/network/redir?"]
+##a[href^="https://playuhd.host/"]
 ##a[href^="https://porndeals.com/?track="]
 ##a[href^="https://porngames.adult/?SID="]
 ##a[href^="https://prf.hn/click/"][href*="/adref:"]
@@ -28880,6 +28988,7 @@ _popunder+$popup
 ##a[href^="https://www.adskeeper.co.uk/"]
 ##a[href^="https://www.adultempire.com/"][href*="?partner_id="]
 ##a[href^="https://www.adxtro.com/"]
+##a[href^="https://www.arthrozene.com/"][href*="?tid="]
 ##a[href^="https://www.bebi.com"]
 ##a[href^="https://www.brazzersnetwork.com/landing/"]
 ##a[href^="https://www.camsoda.com/enter.php?id="]
@@ -28896,9 +29005,9 @@ _popunder+$popup
 ##a[href^="https://www.oboom.com/ad/"]
 ##a[href^="https://www.popads.net/users/"]
 ##a[href^="https://www.pornhat.com/"][rel="nofollow"]
-##a[href^="https://www.secureupload.eu/suprerefid="]
 ##a[href^="https://www.share-online.biz/affiliate/"]
 ##a[href^="https://www.spyoff.com/"]
+##a[href^="https://www.travelzoo.com/oascampaignclick/"]
 ##a[href^="https://www.what-sexdating.com/"]
 ##a[href^="https://zononi.com/"]
 ##a[onclick*="//m.economictimes.com/etmack/click.htm"]
@@ -28949,7 +29058,6 @@ _popunder+$popup
 ##div[data-spotim-slot]
 ##div[data-subscript="Advertising"]
 ##div[id^="ADV-SLOT-"]
-##div[id^="MarketGid"]
 ##div[id^="YFBMSN"]
 ##div[id^="acm-ad-tag-"]
 ##div[id^="ad-cid-"]
@@ -29022,8 +29130,6 @@ _popunder+$popup
 ##input[onclick^="window.open('http://www.friendlyduck.com/"]
 ! ezoic
 ###ezmob_footer
-##.ezo_ad
-##.ezoic-floating-bottom
 ! Anti-adblock (https://forums.lanik.us/viewtopic.php?f=62&t=32738)
 ###\5f _nq__hh[style="display:block!important"]
 ! Trust zone
@@ -29060,7 +29166,14 @@ _popunder+$popup
 ! Genric mobile element
 ###mobile-swipe-banner
 ! Sinclair Broadcast Group
+###banner_pos1_ddb_0
+###banner_pos2_ddb_0
+###banner_pos3_ddb_0
+###banner_pos4_ddb_0
 ###rightrail_bottom_ddb_0
+###rightrail_pos1_ddb_0
+###rightrail_pos2_ddb_0
+###rightrail_pos3_ddb_0
 ###rightrail_top_ddb_0
 ###story_bottom_ddb_0
 ###story_top_ddb_0
@@ -29084,7 +29197,7 @@ _popunder+$popup
 ###assetsListings[style="display: block;"]
 ! Magnify transparient advert on video
 ###magnify_widget_playlist_item_companion
-! Playbb.me / easyvideo.me / videozoo.me / paypanda.net
+! easyvideo.me / videozoo.me / paypanda.net
 ###flowplayer > div[style="position: absolute; width: 300px; height: 275px; left: 222.5px; top: 85px; z-index: 999;"]
 ###flowplayer > div[style="z-index: 208; position: absolute; width: 300px; height: 275px; left: 222.5px; top: 85px;"]
 ##.Mpopup + #Mad > #MadZone
@@ -29098,6 +29211,8 @@ _popunder+$popup
 ###center_col > #resultStats + #tads + #res + #tads
 ###center_col > #resultStats + div + #res + #tads
 ###center_col > #resultStats + div[style="border:1px solid #dedede;margin-bottom:11px;padding:5px 7px 5px 6px"]
+###center_col > #taw > #tvcap > .commercial-unit-desktop-top
+###center_col > #taw > #tvcap > .cu-container > .commercial-unit-desktop-top
 ###center_col > #taw > #tvcap > .rscontainer
 ###center_col > div[style="font-size:14px;margin-right:0;min-height:5px"] > div[style="font-size:14px;margin:0 4px;padding:1px 5px;background:#fff8e7"]
 ###cnt #center_col > #res > #topstuff > .ts
@@ -29132,10 +29247,10 @@ _popunder+$popup
 ##.GKJYXHBF2 > .GKJYXHBE2 > .GKJYXHBH5
 ##.GPMV2XEDA2 > .GPMV2XEDP1 > .GPMV2XEDJBB
 ##.ch[onclick="ga(this,event)"]
-##.commercial-unit-desktop-rhs
-##.commercial-unit-desktop-top
+##.commercial-unit-desktop-rhs > .iKidV > .Ee92ae + .P2mpm + .hp3sk
+##.commercial-unit-desktop-rhs:not(.mnr-c)
 ##.commercial-unit-mobile-bottom
-##.commercial-unit-mobile-top
+##.commercial-unit-mobile-top .jackpot-main-content-container > .UpgKEd + .nZZLFc > .vci
 ##.gws-flights-book__ads-wrapper
 ##.lads[width="100%"][style="background:#FFF8DD"]
 ##.mod > ._jH + .rscontainer
@@ -29285,7 +29400,7 @@ adblockplus.org,clipconverter.cc#@##adblock
 amfiindia.com#@##adbody
 2leep.com,landwirt.com,quaintmere.de#@##adbox
 games.com#@##adcode
-gamesfreak.net,gifmagic.com,jobs.wa.gov.au,lalovings.com#@##adcontainer
+gamesfreak.net,jobs.wa.gov.au,lalovings.com#@##adcontainer
 about.com,ehow.com#@##adcontainer1
 guloggratis.dk#@##adcontent
 changeofaddressform.com#@##adhead
@@ -29336,6 +29451,7 @@ sudoku.com.au#@##bigad
 eenadu.net,themediaonline.co.za#@##body_ad
 freeshipping.com#@##bottomAds
 unicreatures.com#@##bottom_ad
+www.google.ac,www.google.ad,www.google.ae,www.google.al,www.google.am,www.google.as,www.google.at,www.google.az,www.google.ba,www.google.be,www.google.bf,www.google.bg,www.google.bi,www.google.bj,www.google.bs,www.google.bt,www.google.by,www.google.ca,www.google.cat,www.google.cd,www.google.cf,www.google.cg,www.google.ch,www.google.ci,www.google.cl,www.google.cm,www.google.co.ao,www.google.co.bw,www.google.co.ck,www.google.co.cr,www.google.co.id,www.google.co.il,www.google.co.in,www.google.co.jp,www.google.co.ke,www.google.co.kr,www.google.co.ls,www.google.co.ma,www.google.co.mz,www.google.co.nz,www.google.co.th,www.google.co.tz,www.google.co.ug,www.google.co.uk,www.google.co.uz,www.google.co.ve,www.google.co.vi,www.google.co.za,www.google.co.zm,www.google.co.zw,www.google.com,www.google.com.af,www.google.com.ag,www.google.com.ai,www.google.com.ar,www.google.com.au,www.google.com.bd,www.google.com.bh,www.google.com.bn,www.google.com.bo,www.google.com.br,www.google.com.by,www.google.com.bz,www.google.com.cn,www.google.com.co,www.google.com.cu,www.google.com.cy,www.google.com.do,www.google.com.ec,www.google.com.eg,www.google.com.et,www.google.com.fj,www.google.com.gh,www.google.com.gi,www.google.com.gt,www.google.com.hk,www.google.com.jm,www.google.com.jo,www.google.com.kh,www.google.com.kw,www.google.com.lb,www.google.com.ly,www.google.com.mm,www.google.com.mt,www.google.com.mx,www.google.com.my,www.google.com.na,www.google.com.ng,www.google.com.ni,www.google.com.np,www.google.com.om,www.google.com.pa,www.google.com.pe,www.google.com.pg,www.google.com.ph,www.google.com.pk,www.google.com.pr,www.google.com.py,www.google.com.qa,www.google.com.ru,www.google.com.sa,www.google.com.sb,www.google.com.sg,www.google.com.sl,www.google.com.sv,www.google.com.tj,www.google.com.tn,www.google.com.tr,www.google.com.tw,www.google.com.ua,www.google.com.uy,www.google.com.vc,www.google.com.ve,www.google.com.vn,www.google.cv,www.google.cz,www.google.de,www.google.dj,www.google.dk,www.google.dm,www.google.dz,www.google.ee,www.google.es,www.google.fi,www.google.fm,www.google.fr,www.google.ga,www.google.ge,www.google.gg,www.google.gl,www.google.gm,www.google.gp,www.google.gr,www.google.gy,www.google.hk,www.google.hn,www.google.hr,www.google.ht,www.google.hu,www.google.ie,www.google.im,www.google.iq,www.google.is,www.google.it,www.google.it.ao,www.google.je,www.google.jo,www.google.jp,www.google.kg,www.google.ki,www.google.kz,www.google.la,www.google.li,www.google.lk,www.google.lt,www.google.lu,www.google.lv,www.google.md,www.google.me,www.google.mg,www.google.mk,www.google.ml,www.google.mn,www.google.ms,www.google.mu,www.google.mv,www.google.mw,www.google.ne,www.google.ne.jp,www.google.ng,www.google.nl,www.google.no,www.google.nr,www.google.nu,www.google.pl,www.google.pn,www.google.ps,www.google.pt,www.google.ro,www.google.rs,www.google.ru,www.google.rw,www.google.sc,www.google.se,www.google.sh,www.google.si,www.google.sk,www.google.sm,www.google.sn,www.google.so,www.google.sr,www.google.st,www.google.td,www.google.tg,www.google.tl,www.google.tm,www.google.tn,www.google.to,www.google.tt,www.google.us,www.google.vg,www.google.vu,www.google.ws#@##bottomads
 hifi-forsale.co.uk#@##centerads
 shoryuken.com#@##cmn_ad_tag_head
 lava360.com#@##content-header-ad
@@ -29430,7 +29546,6 @@ buy.com,superbikeplanet.com#@#.AdTitle
 home-search.org.uk#@#.AdvertContainer
 homeads.co.nz#@#.HomeAds
 travelzoo.com#@#.IM_ad_unit
-wikia.com#@#.LazyLoadAd
 ehow.com#@#.RelatedAds
 everydayhealth.com#@#.SponsoredContent
 apartments.com#@#.ad-300x250
@@ -29441,7 +29556,7 @@ felcia.co.uk#@#.ad-body
 auctionstealer.com#@#.ad-border
 members.portalbuzz.com#@#.ad-btn
 assetbar.com,jazzradio.com,o2.pl#@#.ad-button
-asiasold.com,bahtsold.com,propertysold.asia#@#.ad-cat
+bahtsold.com,propertysold.asia#@#.ad-cat
 small-universe.com#@#.ad-cell
 jobmail.co.za,odysseyware.com#@#.ad-display
 foxnews.com,yahoo.com#@#.ad-enabled
@@ -29499,7 +29614,7 @@ namesecure.com,superhry.cz#@#.adHolder
 superhry.cz#@#.adHoldert
 autotrader.co.za,gumtree.co.nz,gumtree.co.za,gumtree.com,gumtree.com.au,gumtree.ie,gumtree.pl,gumtree.sg,ikea.com,kijiji.ca,ksl.com#@#.adImg
 ceskatelevize.cz,ct24.cz,escortera.com#@#.adItem
-greatergood.com,uol.com.br#@#.adLink
+greatergood.com,tweakers.net,uol.com.br#@#.adLink
 abc.go.com#@#.adMessage
 seznam.cz#@#.adMiddle
 cheaptickets.com,orbitz.com#@#.adMod
@@ -29585,7 +29700,7 @@ bannerist.com#@#.ads-right
 apple.com#@#.ads-section
 community.pictavo.com,juicesky.com#@#.ads-title
 queer.pl#@#.ads-top
-getwallpapers.com,uploadbaz.com#@#.ads1
+getwallpapers.com#@#.ads1
 jw.org#@#.adsBlock
 download.cnet.com#@#.ads_catDiv
 santabanta.com#@#.ads_div
@@ -29629,7 +29744,6 @@ itavisen.no#@#.advertisement-1
 zalora.co.id,zalora.co.th,zalora.com.my,zalora.com.ph,zalora.sg#@#.advertisement-block
 wired.com#@#.advertisement__leaderboard
 buyout.pro,news.com.au,zlinked.com#@#.advertiser
-alusa.org#@#.advertising_block
 anobii.com,ceporn.net#@#.advertisment
 grist.org,ing.dk,version2.dk#@#.advertorial
 bavaria86.com,ransquawk.com,trh.sk#@#.adverts
@@ -29641,7 +29755,7 @@ deluxemusic.tv#@#.article_ad
 jiji.ng#@#.b-advert
 pbs.org#@#.banner-ad
 annfammed.org#@#.banner-ads
-plus.net,putlocker.com#@#.banner300
+plus.net#@#.banner300
 mlb.com#@#.bannerAd
 milenio.com#@#.banner_728x90
 mergermarket.com#@#.banner_ad
@@ -29722,12 +29836,13 @@ silveradoss.com#@#.ipsAd
 magazines-download.com#@#.item-ads
 amazinglytimedphotos.com#@#.item-container-ad
 rollingstone.com#@#.js-sticky-ad
+kseries.me#@#.jw-ad
 everybodysucksbutus.com,usatoday.com#@#.leaderboard-ad
 ajcn.org,annfammed.org#@#.leaderboard-ads
 lolhit.com#@#.leftAd
 lolhit.com#@#.leftad
 ebayclassifieds.com#@#.list-ad
-asiasold.com,bahtsold.com,comodoroenventa.com,propertysold.asia#@#.list-ads
+bahtsold.com,comodoroenventa.com,propertysold.asia#@#.list-ads
 euspert.com#@#.listad
 atea.com,ateadirect.com,knowyourmobile.com,nlk.org.np#@#.logo-ad
 eagleboys.com.au#@#.marketing-ad
@@ -29748,7 +29863,7 @@ bachofen.ch#@#.pfAd
 speedtest.net#@#.plainAd
 m.vporn.com#@#.playerAd
 iitv.info#@#.player_ad
-putlocker.com,vodu.ch#@#.player_hover_ad
+vodu.ch#@#.player_hover_ad
 bigfootpage.com,gumtree.com#@#.post-ad
 venturebeat.com#@#.post-sponsored
 ayosdito.ph,christianhouseshare.com.au,trovit.pl#@#.post_ad
@@ -29838,6 +29953,7 @@ revimedia.com#@#a[href*=".revimedia.com/"]
 trust.zone#@#a[href*=".trust.zone"]
 bitrebels.com#@#a[href*="/adrotate-out.php?"]
 theporndude.com#@#a[href*="theporndude.com"]
+pornstarbyface.com#@#a[href^="//awejmp.com/"]
 santander.co.uk#@#a[href^="http://ad-emea.doubleclick.net/"]
 jabong.com,people.com,techrepublic.com,time.com#@#a[href^="http://ad.doubleclick.net/"]
 pcmag.com,watchever.de#@#a[href^="http://adfarm.mediaplex.com/"]
@@ -29859,6 +29975,7 @@ google.ca,google.co.nz,google.co.uk,google.com,google.com.au,google.de#@#a[href^
 socialsex.com#@#a[href^="http://www.socialsex.com/"]
 fuckbookhookups.com#@#a[href^="http://www.yourfuckbook.com/?"]
 buzzfeed.com#@#a[href^="https://ad.doubleclick.net/"]
+badoinkvr.com#@#a[href^="https://badoinkvr.com/"]
 healthmeans.com#@#a[href^="https://servedbyadbutler.com/"]
 trust.zone#@#a[href^="https://trust.zone/"]
 financeads.de#@#a[href^="https://www.financeads.net/tc.php?"]
@@ -29869,7 +29986,7 @@ cookinglight.com,ew.com,foodandwine.com,fortune.com,hellogiggles.com,myrecipes.c
 marketgid.com,mgid.com#@#div[id^="MarketGid"]
 sensacionalista.com.br#@#div[id^="advads-"]
 flightcentre.co.uk,out.com#@#div[id^="dfp-ad-"]
-amazon.com,beqala.com,concursovirtual.com.br,daveramsey.com,drupalcommerce.org,ensonhaber.com,eurweb.com,faceyourmanga.com,isc2.org,lavozdegalicia.es,liverc.com,liverpoolfc.com,loksatta.com,mit.edu,muscatdaily.com,olx.pl,payback.pl,peekyou.com,pianobuyer.com,podomatic.com,ripley.cl,ripley.com.pe,suntimes.com,timesofoman.com,virginaustralia.com,wlj.net,zavvi.com#@#div[id^="div-gpt-ad"]
+amazon.com,concursovirtual.com.br,daveramsey.com,drupalcommerce.org,ensonhaber.com,eurweb.com,faceyourmanga.com,isc2.org,lavozdegalicia.es,liverc.com,liverpoolfc.com,loksatta.com,mit.edu,muscatdaily.com,olx.pl,payback.pl,peekyou.com,pianobuyer.com,podomatic.com,ripley.cl,ripley.com.pe,suntimes.com,timesofoman.com,virginaustralia.com,wlj.net,zavvi.com#@#div[id^="div-gpt-ad"]
 daveramsey.com,foodkick.com,olx.pl,ripley.cl,ripley.com.pe#@#div[id^="google_ads_iframe_"]
 lavozdegalicia.es#@#div[itemtype="http://schema.org/WPAdBlock"]
 bodas.com.mx,bodas.net,mariages.net,matrimonio.com,weddingspot.co.uk#@#iframe[id^="google_ads_frame"]
@@ -29877,10 +29994,8 @@ bodas.com.mx,bodas.net,concursovirtual.com.br,daveramsey.com,economist.com,fligh
 weather.yahoo.com#@#iframe[src^="http://ad.yieldmanager.com/"]
 ! Anti-Adblock
 opensubtitles.org#@##AD_Top
-litecoiner.net#@##ad-bottom
 mypoints.com#@##ad-main
-litecoiner.net#@##ad-right
-bitcoiner.net,litecoiner.net#@##ad-top
+bitcoiner.net#@##ad-top
 zeez.tv#@##ad_overlay
 cnet.com#@##adboard
 olweb.tv#@##ads1
@@ -29890,25 +30005,19 @@ spoilertv.com#@##adsensewide
 8muses.com#@##adtop
 anisearch.com,lilfile.com#@##advertise
 yafud.pl#@##bottomAd
-liberallogic101.com#@##headerAd
 thesimsresource.com#@##leaderboardad
-exashare.com#@##player_ads
-iphone-tv.eu#@##sidebar_ad
-freebitcoins.nx.tc,getbitcoins.nx.tc#@##sponsorText
 aplus.com,explosm.net#@##sponsoredwellcontainerbottom
 wornandwound.com#@#.ad-grid
-dailybitcoins.org#@#.ad-img
 fox.com#@#.ad-unit
 grifthost.com#@#.ad468
-biggestplayer.me#@#.adBlock
 apkmirror.com#@#.adsWidget
-androidrepublic.org,anonymousemail.me,apkmirror.com,bitcoin-faucet.eu,boxbit.co.in,bsmotoring.com,btcinfame.com,classic-retro-games.com,coingamez.com,demos.krajee.com,doulci.net,eveskunk.com,filecore.co.nz,freebitco.in,get-bitcoin-free.eu,gnomio.com,kadinlarkulubu.com,liberallogic101.com,mangacap.com,mangakaka.com,niresh.co,nzb.su,orlygift.com,pixiz.com,r1db.com,sc2casts.com,spoilertv.com,unlocktheinbox.com,zeperfs.com#@#.adsbygoogle
+androidrepublic.org,anonymousemail.me,apkmirror.com,boxbit.co.in,bsmotoring.com,classic-retro-games.com,coingamez.com,demos.krajee.com,doulci.net,eveskunk.com,filecore.co.nz,freebitco.in,gnomio.com,kadinlarkulubu.com,niresh.co,nzb.su,orlygift.com,pixiz.com,r1db.com,sc2casts.com,spoilertv.com,unlocktheinbox.com,zeperfs.com#@#.adsbygoogle
 apkmirror.com#@#.adslot
 browsershots.org#@#.advert_area
 wtkplay.pl#@#.advertising_banner
 velasridaura.com#@#.advertising_block
 guitarforum.co.za,tf2r.com#@#.adverts
-africasports.net,bakersfield.com,biggestplayer.me,cheatpain.com,diplomat.so,directwonen.nl,dramacafe.in,eveskunk.com,exashare.com,farsondigitalwatercams.com,file4go.com,freeccnaworkbook.com,gaybeeg.info,hack-sat.com,is-arquitectura.es,jornaisdesportivospdf.com,keygames.com,latesthackingnews.com,localeyes.dk,manga2u.co,mangakaka.com,mangasky.co,minecraftskins.com,online.dramacafe.tv,perrosycachorros.net,phoronix.com,ps3news.com,psarips.com,psicologiayautoayuda.com,recetasreceta.com,smplayer.sourceforge.net,thenewboston.com,tubitv.com,youtubecristiano.net#@#.afs_ads
+africasports.net,bakersfield.com,cheatpain.com,diplomat.so,directwonen.nl,dramacafe.in,eveskunk.com,farsondigitalwatercams.com,file4go.com,freeccnaworkbook.com,gaybeeg.info,hack-sat.com,is-arquitectura.es,jornaisdesportivospdf.com,keygames.com,latesthackingnews.com,localeyes.dk,manga2u.co,mangasky.co,minecraftskins.com,online.dramacafe.tv,perrosycachorros.net,phoronix.com,ps3news.com,psarips.com,psicologiayautoayuda.com,recetasreceta.com,smplayer.sourceforge.net,thenewboston.com,tubitv.com,youtubecristiano.net#@#.afs_ads
 coindigger.biz#@#.banner160x600
 anisearch.com#@#.chitikaAdBlock
 theladbible.com#@#.content_tagsAdTech
@@ -29943,7 +30052,6 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||1100i.com^$third-party
 ||123date.me^$third-party
 ||12place.com^$third-party
-||13vm73vbmp.com^$third-party
 ||152media.com^$third-party
 ||15f3c01a.info^$third-party
 ||15f3c01c.info^$third-party
@@ -29956,7 +30064,6 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||194.71.107.25^$third-party
 ||199.102.225.178^$third-party,domain=~adsimilate.ip
 ||1bx4t5c.com^$third-party
-||1ccbt.com^$third-party
 ||1clickdownloads.com^$third-party
 ||1e0y.xyz^$third-party
 ||1empiredirect.com^$third-party
@@ -29982,12 +30089,13 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||2beon.co.kr^$third-party
 ||2d4c3870.info^$third-party
 ||2d4c3872.info^$third-party
+||2d7bd9e6eb370143.com^$third-party
 ||2dpt.com^$third-party
 ||2gok8g15p2.com^$third-party
 ||2leep.com^$third-party
 ||2mdn.info^$third-party
 ||2mdn.net/dot.gif$object-subrequest,third-party
-||2mdn.net^$object-subrequest,third-party,domain=101cargames.com|1025thebull.com|1031iheartaustin.com|1037theq.com|1041beat.com|1053kissfm.com|1057ezrock.com|1067litefm.com|10news.com|1310news.com|247comedy.com|3news.co.nz|49ers.com|610cktb.com|680news.com|700wlw.com|850koa.com|923jackfm.com|92q.com|940winz.com|94hjy.com|99kisscountry.com|abc15.com|abc2news.com|abcactionnews.com|am1300thezone.com|atlantafalcons.com|automobilemag.com|automotive.com|azcardinals.com|baltimoreravens.com|baynews9.com|bbc.co.uk|bbc.com|belfasttelegraph.co.uk|bengals.com|bet.com|big1059.com|bigdog1009.ca|bloomberg.com|bnn.ca|boom92houston.com|boom945.com|boom973.com|boom997.com|boomphilly.com|box10.com|brisbanetimes.com.au|buccaneers.com|buffalobills.com|bullz-eye.com|calgaryherald.com|caller.com|canada.com|capitalfm.ca|cbslocal.com|cbsnews.com|cbssports.com|channel955.com|chargers.com|chez106.com|chfi.com|chicagobears.com|chicagotribune.com|cj104.com|cjad.com|cjbk.com|clevelandbrowns.com|cnet.com|coast933.com|colts.com|commercialappeal.com|country1011.com|country1043.com|country1067.com|country600.com|courierpress.com|cp24.com|cricketcountry.com|csmonitor.com|ctvnews.ca|dallascowboys.com|denverbroncos.com|detroitlions.com|drive.com.au|earthcam.com|easyrecipesite.com|edmontonjournal.com|egirlgames.net|elvisduran.com|enjoydressup.com|entrepreneur.com|eonline.com|escapegames.com|euronews.com|eurosport.com|eveningecho.ie|fm98wjlb.com|foodnetwork.ca|four.co.nz|foxradio.ca|foxsportsradio.com|gamingbolt.com|ghananation.com|giantbomb.com|giants.com|globalnews.ca|globaltoronto.com|globaltv.com|globaltvbc.com|globaltvcalgary.com|go.com|gorillanation.com|gosanangelo.com|hallelujah1051.com|hellobeautiful.com|heraldsun.com.au|hgtv.ca|hiphopnc.com|hot1041stl.com|hotair.com|hothiphopdetroit.com|hotspotatl.com|houstontexans.com|ibtimes.co.uk|ign.com|iheart.com|independent.ie|independentmail.com|indyhiphop.com|ipowerrichmond.com|jackfm.ca|jaguars.com|jwplatform.com|kase101.com|kcchiefs.com|kcci.com|kcra.com|kdvr.com|kfiam640.com|kgbx.com|khow.com|kiisfm.com|kiss925.com|kissnorthbay.com|kisssoo.com|kisstimmins.com|kitsapsun.com|kitv.com|kjrh.com|knoxnews.com|kogo.com|komonews.com|kshb.com|kwgn.com|kxan.com|kysdc.com|latimes.com|latinchat.com|leaderpost.com|livestream.com|local8now.com|magic96.com|majorleaguegaming.com|metacafe.com|miamidolphins.com|mix923fm.com|moneycontrol.com|montrealgazette.com|motorcyclistonline.com|moviemistakes.com|mtv.ca|myboom1029.com|mycolumbuspower.com|myezrock.com|naplesnews.com|nationalpost.com|nba.com|ndtv.com|neworleanssaints.com|news1130.com|newsinc.com|newsmax.com|newsmaxhealth.com|newsnet5.com|newsone.com|newstalk1010.com|newstalk1130.com|newyorkjets.com|nydailynews.com|nymag.com|oldschoolcincy.com|ottawacitizen.com|packers.com|panthers.com|patriots.com|pcworld.com|philadelphiaeagles.com|play.it|player.screenwavemedia.com|prowrestling.com|q92timmins.com|raaga.com|radio.com|radionowindy.com|raiders.com|rapbasement.com|redding.com|redskins.com|reporternews.com|reuters.com|rollingstone.com|rootsports.com|rottentomatoes.com|seahawks.com|sherdog.com|skynews.com.au|slice.ca|smh.com.au|sploder.com|sportsnet590.ca|sportsnet960.ca|springboardplatform.com|steelers.com|stlouisrams.com|streetfire.net|stuff.co.nz|tcpalm.com|telegraph.co.uk|theage.com.au|theaustralian.com.au|thebeatdfw.com|theboxhouston.com|thedenverchannel.com|thedrocks.com|theindychannel.com|theprovince.com|thestarphoenix.com|tide.com|timescolonist.com|timeslive.co.za|timesrecordnews.com|titansonline.com|totaljerkface.com|townhall.com|tripadvisor.ca|tripadvisor.co.uk|tripadvisor.co.za|tripadvisor.com|tripadvisor.com.au|tripadvisor.com.my|tripadvisor.com.sg|tripadvisor.ie|tripadvisor.in|turnto23.com|tvone.tv|twitchy.com|usmagazine.com|vancouversun.com|vcstar.com|veetle.com|vice.com|videojug.com|viki.com|vikings.com|virginradio.ca|vzaar.com|wapt.com|washingtonpost.com|washingtontimes.com|wcpo.com|wdfn.com|weather.com|wescfm.com|wgci.com|wibw.com|wikihow.com|windsorstar.com|wiod.com|wiznation.com|wjdx.com|wkyt.com|wor710.com|wptv.com|wsj.com|wxyz.com|wyff4.com|yahoo.com|youtube.com|z100.com|zhiphopcleveland.com
+||2mdn.net^$object-subrequest,third-party,domain=101cargames.com|1025thebull.com|1031iheartaustin.com|1037theq.com|1041beat.com|1053kissfm.com|1057ezrock.com|1067litefm.com|10news.com|1310news.com|247comedy.com|49ers.com|610cktb.com|680news.com|700wlw.com|850koa.com|923jackfm.com|92q.com|940winz.com|94hjy.com|99kisscountry.com|abc15.com|abc2news.com|abcactionnews.com|am1300thezone.com|atlantafalcons.com|automobilemag.com|automotive.com|azcardinals.com|baltimoreravens.com|baynews9.com|bbc.co.uk|bbc.com|bengals.com|bet.com|big1059.com|bigdog1009.ca|bloomberg.com|bnn.ca|boom92houston.com|boom945.com|boom973.com|boom997.com|boomphilly.com|box10.com|brisbanetimes.com.au|buccaneers.com|buffalobills.com|bullz-eye.com|calgaryherald.com|caller.com|canada.com|capitalfm.ca|cbslocal.com|cbsnews.com|cbssports.com|channel955.com|chargers.com|chez106.com|chfi.com|chicagobears.com|chicagotribune.com|cj104.com|cjad.com|cjbk.com|clevelandbrowns.com|cnet.com|coast933.com|colts.com|commercialappeal.com|country1011.com|country1043.com|country1067.com|country600.com|courierpress.com|cp24.com|cricketcountry.com|csmonitor.com|ctvnews.ca|dallascowboys.com|denverbroncos.com|detroitlions.com|drive.com.au|earthcam.com|edmontonjournal.com|egirlgames.net|elvisduran.com|enjoydressup.com|entrepreneur.com|eonline.com|euronews.com|eurosport.com|eveningecho.ie|fm98wjlb.com|foodnetwork.ca|four.co.nz|foxradio.ca|foxsportsradio.com|gamingbolt.com|ghananation.com|giantbomb.com|giants.com|globalnews.ca|globaltoronto.com|globaltv.com|globaltvbc.com|globaltvcalgary.com|go.com|gorillanation.com|gosanangelo.com|hallelujah1051.com|hellobeautiful.com|heraldsun.com.au|hgtv.ca|hiphopnc.com|hot1041stl.com|hotair.com|hothiphopdetroit.com|hotspotatl.com|houstontexans.com|ibtimes.co.uk|ign.com|iheart.com|independentmail.com|indyhiphop.com|ipowerrichmond.com|jackfm.ca|jaguars.com|jwplatform.com|kase101.com|kcchiefs.com|kcci.com|kcra.com|kdvr.com|kfiam640.com|kgbx.com|khow.com|kiisfm.com|kiss925.com|kissnorthbay.com|kisssoo.com|kisstimmins.com|kitsapsun.com|kitv.com|kjrh.com|knoxnews.com|kogo.com|komonews.com|kshb.com|kwgn.com|kxan.com|kysdc.com|latimes.com|latinchat.com|leaderpost.com|livestream.com|local8now.com|magic96.com|metacafe.com|miamidolphins.com|mix923fm.com|moneycontrol.com|montrealgazette.com|motorcyclistonline.com|moviemistakes.com|mtv.ca|myboom1029.com|mycolumbuspower.com|myezrock.com|naplesnews.com|nationalpost.com|nba.com|ndtv.com|neworleanssaints.com|news1130.com|newsmax.com|newsmaxhealth.com|newsnet5.com|newsone.com|newstalk1010.com|newstalk1130.com|newyorkjets.com|nydailynews.com|nymag.com|oldschoolcincy.com|ottawacitizen.com|packers.com|panthers.com|patriots.com|pcworld.com|philadelphiaeagles.com|play.it|player.screenwavemedia.com|prowrestling.com|q92timmins.com|raaga.com|radio.com|radionowindy.com|raiders.com|rapbasement.com|redding.com|redskins.com|reporternews.com|reuters.com|rollingstone.com|rootsports.com|rottentomatoes.com|seahawks.com|sherdog.com|skynews.com.au|slice.ca|smh.com.au|sploder.com|sportsnet590.ca|sportsnet960.ca|springboardplatform.com|steelers.com|stlouisrams.com|streetfire.net|stuff.co.nz|tcpalm.com|telegraph.co.uk|theage.com.au|theaustralian.com.au|thebeatdfw.com|theboxhouston.com|thedenverchannel.com|thedrocks.com|theindychannel.com|theprovince.com|thestarphoenix.com|tide.com|timescolonist.com|timeslive.co.za|timesrecordnews.com|titansonline.com|totaljerkface.com|townhall.com|tripadvisor.ca|tripadvisor.co.uk|tripadvisor.co.za|tripadvisor.com|tripadvisor.com.au|tripadvisor.com.my|tripadvisor.com.sg|tripadvisor.ie|tripadvisor.in|turnto23.com|tvone.tv|twitchy.com|usmagazine.com|vancouversun.com|vcstar.com|veetle.com|vice.com|videojug.com|viki.com|vikings.com|virginradio.ca|vzaar.com|wapt.com|washingtonpost.com|washingtontimes.com|wcpo.com|wdfn.com|weather.com|wescfm.com|wgci.com|wibw.com|wikihow.com|windsorstar.com|wiod.com|wiznation.com|wjdx.com|wkyt.com|wor710.com|wptv.com|wsj.com|wxyz.com|wyff4.com|yahoo.com|youtube.com|z100.com|zhiphopcleveland.com
 ||2mdn.net^$~object-subrequest,third-party
 ||2pxg8bcf.top^$third-party
 ||2ssltome.ga^$third-party
@@ -30001,6 +30109,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||33across.com^$third-party
 ||35.184.98.90^$third-party
 ||350media.com^$third-party
+||3585656d9351553f.com^$third-party
 ||360ads.com^$third-party
 ||360adstrack.com^$third-party
 ||360installer.com^$third-party
@@ -30025,16 +30134,19 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||46.165.197.153^
 ||46.165.197.231^
 ||46.246.120.230^$third-party,domain=~adexprt.com.ip
+||47f624b2e6c6072e.com^$third-party
 ||49feqdpw.com^$third-party
 ||4affiliate.net^$third-party
+||4b6994dfa47cee4.com^$third-party
 ||4dsbanner.net^$third-party
 ||4dsply.com^$third-party
 ||4e43ac9c.info^$third-party
 ||4uvjosuc.com^$third-party
 ||4wnet.com^$third-party
+||4wnetwork.com^$third-party
 ||50.7.243.123^$third-party
 ||5362367e.info^$third-party
-||565an8qpws.com^$third-party
+||564d28256cddaeba.com^$third-party
 ||5advertise.com^$third-party
 ||5clickcashsoftware.com^$third-party
 ||5gl1x9qc.com^$third-party
@@ -30042,20 +30154,20 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||600z.com^$third-party
 ||6198399e4910e66-ovc.com^$third-party
 ||62.27.51.163^$third-party,domain=~adlive.de.ip
-||62b70ac32d4614b.com^$third-party
 ||63.225.61.4^$third-party
 ||64.20.60.123^$third-party
 ||67s6gxv28kin.com^$third-party
 ||6kauqbszb9.com^$third-party
 ||6zy9yqe1ew.com^$third-party
-||72b8869dfc34690.com^$third-party
+||73g509fk9a.com^$third-party
 ||74.117.182.77^
+||7667bab1751ff777.com^$third-party
 ||777seo.com^$third-party
 ||778669.com^$third-party
 ||78.138.126.253^$third-party
 ||78.140.131.214^
-||78tdd75.com^$third-party
 ||79zgycmr.com^$third-party
+||7hu8e1u001.com^$third-party
 ||7insight.com^$third-party
 ||7pud.com^$third-party
 ||7search.com^$third-party
@@ -30063,17 +30175,16 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||7v8rya73sj.com^$third-party
 ||82d914.se^$third-party
 ||87.230.102.24^$third-party,domain=~p2p.adserver.ip
-||87159d7b62fc885.com^$third-party
 ||88461059da0a12ea.com^$third-party
 ||888media.net^$third-party
 ||888medianetwork.com^$third-party
 ||888promos.com^$third-party
-||8baf7ae42000024.com^$third-party
 ||8s8.eu^$third-party
 ||8yxupue8.com^$third-party
 ||91mobiles.com^$third-party
 ||93c8c9a28e1db445.com^$third-party
 ||97d73lsi.com^$third-party
+||98bf9h8jbg.com^$third-party
 ||9ads.mobi^$third-party
 ||9d63c80da.pw^$third-party
 ||9ts3tpia.com^$third-party
@@ -30083,6 +30194,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||a.adroll.com^$third-party
 ||a.ligatus.com^$third-party
 ||a.raasnet.com^$third-party
+||a1a5ab31bcd1bc68.com^$third-party
 ||a2b108bd2461b12e.com^$third-party
 ||a2dfp.net^$third-party
 ||a2gw.com^$third-party
@@ -30095,6 +30207,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||a4to4.pw^$third-party
 ||a5a5a.com^$third-party
 ||a5pub.com^$third-party
+||a9nf3hg5c2.com^$third-party
 ||aa.voice2page.com^$third-party
 ||aaa.at4.info^$third-party
 ||aaa.dv0.info^$third-party
@@ -30185,6 +30298,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||adagora.com^$third-party
 ||adalliance.io^$third-party
 ||adalso.com^$third-party
+||adamatic.co^$third-party
 ||adaos-ads.net^$third-party
 ||adap.tv^$~object-subrequest,third-party
 ||adapd.com^$third-party
@@ -30292,6 +30406,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||adgatemedia.com^$third-party
 ||adgear.com^$third-party
 ||adgebra.co.in^$third-party
+||adgebra.in^$third-party
 ||adgent007.com^$third-party
 ||adgila.com^$third-party
 ||adgine.net^$third-party
@@ -30506,6 +30621,8 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||adrunnr.com^$third-party
 ||ads-4u.com^$third-party
 ||ads-elsevier.net^$third-party
+||ads-for-free.com^$third-party
+||ads-pixiv.net^$third-party
 ||ads-stats.com^$third-party
 ||ads-twitter.com^$third-party
 ||ads.cc^$third-party
@@ -30563,16 +30680,12 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||adshark.site^$third-party
 ||adshexa.com^$third-party
 ||adshopping.com^$third-party
-||adshost1.com^$third-party
-||adshost2.com^$third-party
 ||adshot.de^$third-party
 ||adshuffle.com^$third-party
 ||adsiduous.com^$third-party
 ||adsignals.com^$third-party
 ||adsimilis.com^$third-party
 ||adsinimages.com^$third-party
-||adsjudo.com.^$third-party
-||adsjudo.com^$third-party
 ||adskeeper.co.uk^$third-party
 ||adslala.com^$third-party
 ||adslidango.com^$third-party
@@ -30734,7 +30847,6 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||advrtice.com^$third-party
 ||advserver.xyz^$third-party
 ||advsnx.net^$third-party
-||adwalte.info^$third-party
 ||adwebster.com^$third-party
 ||adwires.com^$third-party
 ||adwordsservicapi.com^$third-party
@@ -30748,6 +30860,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||adxion.com^$third-party
 ||adxpose.com^$third-party
 ||adxpower.com^$third-party
+||adxpremium.com^$third-party
 ||adxprts.com^$third-party
 ||adxprtz.com^$third-party
 ||adxscope.com^$third-party
@@ -30773,7 +30886,6 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||adzpower.com^$third-party
 ||adzs.nl^$third-party
 ||adzyou.com^$third-party
-||ae1a1e258b8b016.com^$third-party
 ||aepetor.pw^$third-party
 ||aerobins.com^$third-party
 ||af201768865.com^$third-party
@@ -30849,6 +30961,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||agomwefq.com^$third-party
 ||agvzvwof.com^$third-party
 ||aidaigry.com^$third-party
+||ailanibah.com^$third-party
 ||ailtumty.net^$third-party
 ||aim4media.com^$third-party
 ||aimatch.com^$third-party
@@ -30864,6 +30977,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||alchemysocial.com^$third-party
 ||alfynetwork.com^$third-party
 ||algovid.com^$third-party
+||ali-crm.ru^$third-party
 ||alibestru.ru^$third-party
 ||alibestru3.ru^$third-party
 ||alikelys.com^$third-party
@@ -30871,6 +30985,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||alipromo.com^$third-party
 ||alkdmsxs.bid^$third-party
 ||allabc.com^$third-party
+||allarmate.club^$third-party
 ||alleliteads.com^$third-party
 ||allmt.com^$third-party
 ||allmyverygreatlife.com^$third-party
@@ -30978,6 +31093,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||asklots.com^$third-party
 ||aso1.net^$third-party
 ||asooda.com^$third-party
+||asqpniwvxea.com^$third-party
 ||asrety.com^$third-party
 ||assetize.com^$third-party
 ||assoc-amazon.ca^$third-party
@@ -30998,6 +31114,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||atomicblast.lol^$third-party
 ||atonato.de^$third-party
 ||atrinsic.com^$third-party
+||attacketslovern.info^$third-party
 ||atterlocus.com^$third-party
 ||atwola.com^$third-party
 ||au2m8.com^$third-party
@@ -31035,7 +31152,6 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||awsmer.com^$third-party
 ||awstaticdn.net^$third-party
 ||awsurveys.com^$third-party
-||axdxmdv.com^$third-party
 ||axill.com^$third-party
 ||ayads.co^$third-party
 ||ayboll.com^$third-party
@@ -31045,15 +31161,17 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||azoogleads.com^$third-party
 ||azorbe.com^$third-party
 ||b117f8da23446a91387efea0e428392a.pl^$third-party
+||b3z29k1uxb.com^$third-party
 ||b4banner.in^$third-party
+||b60228e270e363f6.com^$third-party
 ||babbnrs.com^$third-party
+||babsedrinhi.info^$third-party
 ||backbeatmedia.com^$third-party
 ||backlinks.com^$third-party
 ||badjocks.com^$third-party
 ||bakkels.com^$third-party
 ||baldiro.de^$third-party
 ||bam-bam-slam.com^$third-party
-||bambergerkennanchitinous.com^$third-party
 ||bamboocast.com^$third-party
 ||bamj630h.tech^$third-party
 ||bananaflippy.com^$third-party
@@ -31158,6 +31276,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||bigpulpit.com^$third-party
 ||bijscode.com^$third-party
 ||billypub.com^$third-party
+||bilsyndication.com^$third-party
 ||bimlocal.com^$third-party
 ||bin-layer.de^$third-party
 ||bin-layer.ru^$third-party
@@ -31209,6 +31328,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||bnrs.it^$third-party
 ||bnrslks.com^$third-party
 ||bnserving.com^$third-party
+||boashesu.net^$third-party
 ||bodelen.com^$third-party
 ||bogads.com^$third-party
 ||bohowhepsandked.info^$third-party
@@ -31247,7 +31367,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||brandclik.com^$third-party
 ||brandreachsys.com^$third-party
 ||braside.ru^$third-party
-||brassyobedientcotangent.com^$third-party
+||braun634.com^$third-party
 ||bravenetmedianetwork.com^$third-party
 ||breadpro.com^$third-party
 ||breakingfeedz.com^$third-party
@@ -31312,7 +31432,6 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||buzzonclick.com^$third-party
 ||buzzparadise.com^$third-party
 ||bwinpartypartners.com^$third-party
-||bwknu1lo.top^$third-party
 ||bxkblkok.com^$third-party
 ||byspot.com^$third-party
 ||byvngx98ssphwzkrrtsjhnbyz5zss81dxygxvlqd05.com^$third-party
@@ -31341,7 +31460,6 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||cardincraping.net^$third-party
 ||carrier.bz^$third-party
 ||cartorkins.com^$third-party
-||cartstick.com^$third-party
 ||casalemedia.com^$third-party
 ||cash-duck.com^$third-party
 ||cash4members.com^$third-party
@@ -31370,6 +31488,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||cc-dt.com^$third-party
 ||cd828.com^$third-party
 ||cdn.mobicow.com^$third-party
+||cdn000.club^$script,third-party
 ||cdn7now.com^$third-party
 ||cdna.tremormedia.com^$third-party
 ||cdnads.com^$third-party
@@ -31383,7 +31502,9 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||cdnrl.com^$third-party
 ||cdnserv.pw^$third-party
 ||cdnservr.com^$third-party
+||cdntrf.com^$third-party
 ||cdntrip.com^$third-party
+||ceeglagu.net^$third-party
 ||cegludse.net^$third-party
 ||celeritascdn.com^$third-party
 ||centralnervous.net^$third-party
@@ -31395,6 +31516,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||cfasync.ml^$third-party
 ||cfasync.tk^$third-party
 ||cfgr1.com^$third-party
+||cfts1tifqr.com^$third-party
 ||cgecwm.org^$third-party
 ||chainads.io^$third-party
 ||chanagers.com^$third-party
@@ -31422,6 +31544,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||chitika.net^$third-party
 ||chronicads.com^$third-party
 ||cibleclick.com^$third-party
+||citinnoiddidn.pro^$third-party
 ||city-ads.de^$third-party
 ||cityadspix.com^$third-party
 ||citysite.net^$third-party
@@ -31446,6 +31569,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||click4free.info^$third-party
 ||clickable.com^$third-party
 ||clickad.pl^$third-party
+||clickadilla.com^$third-party
 ||clickagy.com^$third-party
 ||clickbet88.com^$third-party
 ||clickbooth.com^$third-party
@@ -31463,7 +31587,6 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||clickkingdom.net^$third-party
 ||clickly.co^$third-party
 ||clickly.me^$third-party
-||clickmngr.com^$third-party
 ||clickmon.co.kr^$third-party
 ||clickmyads.info^$third-party
 ||clicknano.com^$third-party
@@ -31499,6 +31622,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||clnk.me^$third-party
 ||closeveri.com^$third-party
 ||closeveri.info^$third-party
+||clotezar.com^$third-party
 ||clothiquet.info^$third-party
 ||cloudflare.solutions^$third-party
 ||cloudiiv.com^$third-party
@@ -31512,6 +31636,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||cnt.my^$third-party
 ||cntdy.mobi^$third-party
 ||coadvertise.com^$third-party
+||coagricu.net^$third-party
 ||codefund.app^$third-party
 ||codefund.io^$third-party
 ||codeonclick.com^$third-party
@@ -31530,14 +31655,12 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||coinzilla.io^$third-party
 ||colleable.info^$third-party
 ||collection-day.com^$third-party
-||collective-media.net^$third-party
 ||colledin.com^$third-party
 ||colliersads.com^$third-party
 ||com-wkejf32ljd23409system.net^$third-party
 ||combotag.com^$third-party
 ||comclick.com^$third-party
 ||comeadvertisewithus.com^$third-party
-||comegarage.com^$third-party
 ||commercialvalue.org^$third-party
 ||commission-junction.com^$third-party
 ||commission.bz^$third-party
@@ -31552,7 +31675,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||conduit-banners.com^$third-party
 ||conduit-services.com^$third-party
 ||conferentse.com^$third-party
-||conflibred.co^$third-party
+||connectad.io^$third-party
 ||connectedads.net^$third-party
 ||connectignite.com^$third-party
 ||connectionads.com^$third-party
@@ -31560,7 +31683,6 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||connexplace.com^$third-party
 ||connextra.com^$third-party
 ||consivenu.com^$third-party
-||constintptr.com^$third-party
 ||construment.com^$third-party
 ||consumable.com^$third-party
 ||consumergenepool.com^$third-party
@@ -31587,6 +31709,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||coolmirage.com^$third-party
 ||coolsite.club^$third-party
 ||coolyeti.info^$third-party
+||cootewie.com^$third-party
 ||copacet.com^$third-party
 ||cor-natty.com^$third-party
 ||coretarget.co.uk^$third-party
@@ -31634,6 +31757,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||creative-serving.com^$third-party
 ||creativecdn.com^$third-party
 ||creditcards15x.tk^$third-party
+||creditcardsbest.club^$third-party
 ||crispads.com^$third-party
 ||crm4d.com^$third-party
 ||crocspaceoptimizer.com^$third-party
@@ -31672,6 +31796,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||d.ligatus.com^$third-party
 ||d.m3.net^$third-party
 ||d03x2011.com^$third-party
+||d0f85db8ee56f5c6.com^$third-party
 ||d1110e4.se^$third-party
 ||d2.ligatus.com^$third-party
 ||d2ship.com^$third-party
@@ -31683,7 +31808,6 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||daibusee.com^$third-party
 ||daitrff.info^$third-party
 ||danitabedtick.net^$third-party
-||danmeneldur.com^$third-party
 ||danzhallfes.com^$third-party
 ||dapper.net^$third-party
 ||darwarvid.com^$third-party
@@ -31705,7 +31829,6 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||dc121677.com^$third-party
 ||dealcurrent.com^$third-party
 ||debrium-surbara.com^$third-party
-||decademical.com^$third-party
 ||decenthat.com^$third-party
 ||decisionmark.com^$third-party
 ||decisionnews.com^$third-party
@@ -31728,6 +31851,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||delivery49.com^$third-party
 ||delivery51.com^$third-party
 ||delnapb.com^$third-party
+||deloplen.com^$third-party
 ||demand.supply^$third-party
 ||denis-pj0823031-491201b.com^$third-party
 ||deplayer.net^$third-party
@@ -31782,6 +31906,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||distilled.ie^$third-party
 ||districtm.ca^$third-party
 ||dj-updates.com^$third-party
+||djfiln.com^$third-party
 ||djiboutdifficial.info^$third-party
 ||dk4ywix.com^$third-party
 ||dl-rms.com^$third-party
@@ -31897,7 +32022,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||doubleclick.net/pfadx/video.wsj.com/$third-party
 ||doubleclick.net/pfadx/www.tv3.co.nz$third-party
 ||doubleclick.net/xbbe/creative/vast?
-||doubleclick.net^$third-party,domain=92q.com|abc-7.com|addictinggames.com|allbusiness.com|bizjournals.com|bloomberg.com|bnn.ca|boom92houston.com|boom945.com|boomphilly.com|break.com|cbc.ca|cbs19.tv|cbs3springfield.com|cbslocal.com|complex.com|dailymail.co.uk|darkhorizons.com|doubleviking.com|edmunds.com|euronews.com|extratv.com|fandango.com|fox19.com|fox5vegas.com|gorillanation.com|hawaiinewsnow.com|hellobeautiful.com|hiphopnc.com|hot1041stl.com|hothiphopdetroit.com|hotspotatl.com|hulu.com|imdb.com|indiatimes.com|indyhiphop.com|ipowerrichmond.com|joblo.com|kcra.com|kctv5.com|ketv.com|koat.com|koco.com|kolotv.com|kpho.com|kptv.com|ksat.com|ksbw.com|ksfy.com|ksl.com|kypost.com|kysdc.com|live5news.com|livestation.com|livestream.com|metro.us|metronews.ca|miamiherald.com|my9nj.com|myboom1029.com|mycolumbuspower.com|nbcrightnow.com|neatorama.com|necn.com|neopets.com|news.com.au|news4jax.com|newshub.co.nz|newsone.com|nintendoeverything.com|oldschoolcincy.com|pagesuite-professional.co.uk|pandora.com|play.it|player.theplatform.com|radio.com|radionowindy.com|rottentomatoes.com|sbsun.com|shacknews.com|sk-gaming.com|ted.com|thebeatdfw.com|theboxhouston.com|theglobeandmail.com|timesnow.tv|tv2.no|ustream.tv|wapt.com|washingtonpost.com|wate.com|wbaltv.com|wcvb.com|wdrb.com|wdsu.com|wflx.com|wfmz.com|wfsb.com|wgal.com|whdh.com|wired.com|wisn.com|wiznation.com|wlky.com|wlns.com|wlwt.com|wmur.com|wnem.com|wowt.com|wral.com|wsj.com|wsmv.com|wsvn.com|wtae.com|wthr.com|wxii12.com|wyff4.com|yahoo.com|youtube-nocookie.com|youtube.com|zhiphopcleveland.com
+||doubleclick.net^$third-party,domain=92q.com|abc-7.com|addictinggames.com|allbusiness.com|bizjournals.com|bloomberg.com|bnn.ca|boom92houston.com|boom945.com|boomphilly.com|break.com|cbc.ca|cbs19.tv|cbs3springfield.com|cbslocal.com|complex.com|dailymail.co.uk|darkhorizons.com|doubleviking.com|edmunds.com|euronews.com|extratv.com|fandango.com|fox19.com|fox5vegas.com|gorillanation.com|hawaiinewsnow.com|hellobeautiful.com|hiphopnc.com|hot1041stl.com|hothiphopdetroit.com|hotspotatl.com|hulu.com|imdb.com|indiatimes.com|indyhiphop.com|ipowerrichmond.com|joblo.com|kcra.com|kctv5.com|ketv.com|koat.com|koco.com|kolotv.com|kpho.com|kptv.com|ksat.com|ksbw.com|ksfy.com|ksl.com|kypost.com|kysdc.com|live5news.com|livestation.com|livestream.com|metro.us|metronews.ca|miamiherald.com|my9nj.com|myboom1029.com|mycolumbuspower.com|nbcrightnow.com|neatorama.com|necn.com|neopets.com|news.com.au|news4jax.com|newshub.co.nz|newsone.com|nintendoeverything.com|oldschoolcincy.com|pagesuite-professional.co.uk|pandora.com|play.it|player.theplatform.com|radio.com|radionowindy.com|rottentomatoes.com|sbsun.com|shacknews.com|sk-gaming.com|ted.com|thebeatdfw.com|theboxhouston.com|theglobeandmail.com|tv2.no|ustream.tv|wapt.com|washingtonpost.com|wate.com|wbaltv.com|wcvb.com|wdrb.com|wdsu.com|wflx.com|wfmz.com|wfsb.com|wgal.com|whdh.com|wired.com|wisn.com|wiznation.com|wlky.com|wlns.com|wlwt.com|wmur.com|wnem.com|wowt.com|wral.com|wsj.com|wsmv.com|wsvn.com|wtae.com|wthr.com|wxii12.com|wyff4.com|yahoo.com|youtube-nocookie.com|youtube.com|zhiphopcleveland.com
 ||doubleclick.net^*/ad/$~object-subrequest,third-party
 ||doubleclick.net^*/adi/$~object-subrequest,third-party
 ||doubleclick.net^*/adj/$~object-subrequest,third-party
@@ -31936,7 +32061,6 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||dreamsearch.or.kr^$third-party
 ||dreyeli.info^$third-party
 ||drnxs.com^$third-party
-||dropzenad.com^$third-party
 ||drowadri.racing^$third-party
 ||drowle.com^$third-party
 ||dsero.net^$third-party
@@ -31999,14 +32123,15 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||eclick.vn^$third-party
 ||econsideepofle.info^$third-party
 ||ecpmrocks.com^$third-party
+||edchargina.pro^$third-party
 ||edgeads.org^$third-party
 ||edgevertise.com^$third-party
 ||ednplus.com^$third-party
 ||edomz.net^$third-party
 ||eedr.org^$third-party
-||eetseemp.net^$third-party
 ||effectivemeasure.net^$third-party
 ||egamingonline.com^$third-party
+||ejoonsoo.net^$third-party
 ||ek8k5dst5c.com^$third-party
 ||ekansovi.com^$third-party
 ||ekmas.com^$third-party
@@ -32026,6 +32151,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||emediate.dk^$third-party
 ||emediate.eu^$third-party
 ||emediate.se^$third-party
+||emkarto.fun^$third-party
 ||empiremoney.com^$third-party
 ||employers-freshly.org^$third-party
 ||emptyspaceads.com^$third-party
@@ -32038,7 +32164,6 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||enterads.com^$third-party
 ||entrecard.com^$third-party
 ||entrecard.s3.amazonaws.com^$third-party
-||eoredi.com^$third-party
 ||eosads.com^$third-party
 ||ep7kpqn8.online^$third-party
 ||epicgameads.com^$third-party
@@ -32049,6 +32174,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||epu.sh^$third-party
 ||eqads.com^$third-party
 ||erado.org^$third-party
+||erberos.xyz^$third-party
 ||erendri.com^$third-party
 ||ergerww.net^$third-party
 ||ergodob.ru^$third-party
@@ -32113,7 +32239,6 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||ezadserver.net^$third-party
 ||ezmob.com^$third-party
 ||ezoic.net^$third-party
-||eztexas.info^$third-party
 ||f-4560.com^$third-party
 ||f3c1cc473b337ded.com^$third-party
 ||f5v1x3kgv5.com^$third-party
@@ -32126,6 +32251,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||falthouse.info^$third-party
 ||fandelcot.com^$third-party
 ||far-far-star.com^$third-party
+||fardan.pw^$third-party
 ||fast2earn.com^$third-party
 ||fastapi.net^$third-party
 ||fastates.net^$third-party
@@ -32136,6 +32262,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||fbcdn2.com^$third-party
 ||fbgdc.com^$third-party
 ||fbsvu.com^$third-party
+||fd9523b31ff93b5c.com^$third-party
 ||fdf4.com^$third-party
 ||fearer.info^$third-party
 ||fearfulflag.com^$third-party
@@ -32151,6 +32278,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||ferrellis.com^$third-party
 ||fessoovy.com^$third-party
 ||feybu.work^$third-party
+||fg09t.com^$third-party
 ||fiberpairjo.link^$third-party
 ||fidel.to^$third-party
 ||filadmir.site^$third-party
@@ -32168,6 +32296,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||findbetterresults.com^$third-party
 ||findepended.com^$third-party
 ||findsthat.com^$third-party
+||findswiftresults.com^$third-party
 ||finverty.info^$third-party
 ||firaxtech.com^$third-party
 ||firefeeder.com^$third-party
@@ -32214,6 +32343,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||focusego.info^$third-party
 ||fogzyads.com^$third-party
 ||follofop.com^$third-party
+||foloatoo.com^$third-party
 ||foocheeb.net^$third-party
 ||foodieblogroll.com^$third-party
 ||foonad.com^$third-party
@@ -32231,6 +32361,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||forrestersurveys.com^$third-party
 ||fortpush.com^$third-party
 ||foundayu.com^$third-party
+||fourmtagservices.com^$third-party
 ||fphnwvkp.info^$third-party
 ||frameptp.com^$third-party
 ||free-domain.net^$third-party
@@ -32260,7 +32391,9 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||funnel-me.com^$third-party
 ||funtikapa.info^$third-party
 ||furginator.pw^$third-party
+||furtherescottom.info^$third-party
 ||fusionads.net^$third-party
+||futsoksu.com^$third-party
 ||future-hawk-content.co.uk^$third-party
 ||futureresiduals.com^$third-party
 ||futureus.com^$third-party
@@ -32276,7 +32409,6 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||g27zkdvsxl.com^$third-party
 ||g3j2wzmon8b.com^$third-party
 ||g4whisperermedia.com^$third-party
-||g5fzq2l.com^$third-party
 ||gagacon.com^$third-party
 ||gagenez.com^$third-party
 ||gainmoneyfast.com^$third-party
@@ -32304,6 +32436,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||gazati.com^$third-party
 ||gbkfkofgks.com^$third-party
 ||gbkfkofgmks.com^$third-party
+||gcomrarlta.com^$third-party
 ||gctwh9xc.site^$third-party
 ||gdmdigital.com^$third-party
 ||geede.info^$third-party
@@ -32341,10 +32474,10 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||getpopunder.com^$third-party
 ||gets-web.space^$third-party
 ||getscorecash.com^$third-party
+||getscriptjs.com^$third-party
 ||getthislistbuildingvideo.biz^$third-party
 ||gettipsz.info^$third-party
 ||getxml.org^$third-party
-||gfdfhdh5t5453.com^$third-party
 ||ggncpm.com^$third-party
 ||giantaffiliates.com^$third-party
 ||gigamega.su^$third-party
@@ -32354,10 +32487,12 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||gitload.site^$third-party
 ||giu9aab.bid^$third-party
 ||gklmedia.com^$third-party
+||glaimtug.com^$third-party
 ||glaswall.online^$third-party
 ||gleaminist.com^$third-party
 ||gleaminist.info^$third-party
 ||glical.com^$third-party
+||gliese-682c.com^$third-party
 ||global-success-club.net^$third-party
 ||globaladmedia.com^$third-party
 ||globaladsales.com^$third-party
@@ -32366,10 +32501,9 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||globalsuccessclub.com^$third-party
 ||globaltakeoff.net^$third-party
 ||globaltraffico.com^$third-party
+||globwo.online^$third-party
 ||glodrips.com^$third-party
-||glotchat.click^$third-party
 ||glowdot.com^$third-party
-||glumifo.info^$third-party
 ||glumtitu.net^$third-party
 ||gmads.net^$third-party
 ||go2affise.com^$third-party
@@ -32405,11 +32539,13 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||gpacalculatorhighschoolfree.com^$third-party
 ||grabmyads.com^$third-party
 ||grabo.bg^$third-party
+||graciamediaweb.com^$third-party
 ||grafpedia.com^$third-party
 ||granodiorite.com^$third-party
 ||grapeshot.co.uk^$third-party
 ||gratisnetwork.com^$third-party
 ||greatedr.com^$third-party
+||greedseed.world^$third-party
 ||green-red.com^$third-party
 ||greenads.org^$third-party
 ||greenlabelppc.com^$third-party
@@ -32475,10 +32611,13 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||healthcarestars.com^$third-party
 ||healthtrader.com^$third-party
 ||hebiichigo.com^$third-party
+||heckhaphanofres.info^$third-party
+||hedtgodingsincy.info^$third-party
 ||helloreverb.com^$third-party
 ||helotero.com^$third-party,domain=~streamcloud.eu
 ||heravda.com^$third-party
 ||herocpm.com^$third-party
+||herofandhist.info^$third-party
 ||hexagram.com^$third-party
 ||hgdat.com^$third-party
 ||hiadone.com^$third-party
@@ -32493,10 +32632,12 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||historest.com^$third-party
 ||hit-now.com^$third-party
 ||hitmarkerjobs.com^$third-party
+||hitme.pw^$third-party
 ||hits.sys.lv^$third-party
 ||hitwastedgarden.com^$third-party
 ||hiug862dj0.com^$third-party
 ||hlads.com^$third-party
+||hlmiq.com^$third-party
 ||hlserve.com^$third-party
 ||hlu9tseh.men^$third-party
 ||hmongcash.com^$third-party
@@ -32517,6 +32658,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||horse-racing-affiliate-program.co.uk^$third-party
 ||horsered.com^$third-party
 ||horyzon-media.com^$third-party
+||hosoojat.net^$third-party
 ||hostgit.net^$third-party
 ||hosticanaffiliate.com^$third-party
 ||hot-hits.us^$third-party
@@ -32552,6 +32694,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||hypeads.org^$third-party
 ||hypemakers.net^$third-party
 ||hyperbanner.net^$third-party
+||hyperboardupil.info^$third-party
 ||hyperlinksecure.com^$third-party
 ||hyperpromote.com^$third-party
 ||hypertrackeraff.com^$third-party
@@ -32575,7 +32718,6 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||idbhsgy.com^$third-party
 ||idealmedia.com^$third-party
 ||identads.com^$third-party
-||idexoro.info^$third-party
 ||idownloadgalore.com^$third-party
 ||idreammedia.com^$third-party
 ||ie8eamus.com^$third-party
@@ -32586,6 +32728,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||igameunion.com^$third-party
 ||igloohq.com^$third-party
 ||ignitioninstaller.com^$third-party
+||ihookupdaily.com^$third-party
 ||iicheewi.com^$third-party
 ||ikzikistheking.com^$third-party
 ||im2ss2ss.top^$third-party
@@ -32656,7 +32799,6 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||information-sale.com^$third-party
 ||infra-ad.com^$third-party
 ||ingame.ad^$third-party
-||injuredcandy.com^$third-party
 ||inktad.com^$third-party
 ||innity.com^$third-party
 ||innity.net^$third-party
@@ -32664,7 +32806,6 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||insightexpress.com^$third-party
 ||insightexpressai.com^$third-party
 ||insitepromotion.com^$third-party
-||insitesystems.com^$third-party
 ||inskinad.com^$third-party
 ||inskinmedia.com^$~stylesheet,third-party
 ||inspiringsweater.xyz^$third-party
@@ -32675,6 +32816,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||instantclk.com^$third-party
 ||instantdollarz.com^$third-party
 ||instantly-ageless.net^$third-party
+||instantresp.com^$third-party
 ||insticator.com^$third-party
 ||instinctiveads.com^$third-party
 ||instivate.com^$third-party
@@ -32724,6 +32866,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||islationa.com^$third-party
 ||isohits.com^$third-party
 ||isparkmedia.com^$third-party
+||istrawzh3.com^$third-party
 ||isubdom.com^$third-party
 ||isubdomains.com^$third-party
 ||it4oop7.bid^$third-party
@@ -32739,7 +32882,6 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||izeads.com^$third-party
 ||jacquarter.com^$third-party
 ||jadcenter.com^$third-party
-||jandolav.com^$third-party
 ||jango.com^$third-party
 ||jangonetwork.com^$third-party
 ||jarvinzo.com^$popup
@@ -32754,6 +32896,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||jdoqocy.com/placeholder-$third-party
 ||jdproject.net^$third-party
 ||jdzw3frs.com^$third-party
+||jeegopte.com^$third-party
 ||jeeh7eet.com^$third-party
 ||jeetyetmedia.com^$third-party
 ||jemmgroup.com^$third-party
@@ -32779,6 +32922,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||jscloud.org^$third-party
 ||jscount.com^$third-party
 ||jsfeedadsget.com^$third-party
+||jsfuz.com^$third-party
 ||jsmentry.com^$third-party
 ||jsmjmp.com^$third-party
 ||jsretra.com^$third-party
@@ -32796,6 +32940,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||jumpelead.com^$third-party
 ||jumptap.com^$third-party
 ||jungloconding.info^$third-party
+||junioneruytew.info^$third-party
 ||jursp.com^$third-party
 ||justpremium.com^$third-party
 ||justrelevant.com^$third-party
@@ -32809,6 +32954,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||kantarmedia.com^$third-party
 ||kaukoafa.net^$third-party
 ||kavanga.ru^$third-party
+||keapeiros.xyz^$third-party
 ||keewurd.com^$third-party
 ||kehalim.com^$third-party
 ||kenduktur.com^$third-party
@@ -32824,7 +32970,6 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||kgidpryrz8u2v0rz37.com^$third-party
 ||khudagi.info^$third-party
 ||kikuzip.com^$third-party
-||kilorama.com^$third-party
 ||kinley.com^$third-party
 ||kintokup.com^$third-party
 ||kiosked.com^$third-party
@@ -32840,6 +32985,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||klixfeed.com^$third-party
 ||kloapers.com^$third-party
 ||klonedaset.org^$third-party
+||klubityd.online^$third-party
 ||kmnjdcrcfhu.com^$third-party
 ||knorex.asia^$third-party
 ||knowd.com^$third-party
@@ -32853,12 +32999,14 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||korexo.com^$third-party
 ||korrelate.net^$third-party
 ||kostprice.com^$third-party
+||koten.zone^$third-party
 ||kovla.com^$third-party
 ||kqzyfj.com/image-$third-party
 ||kqzyfj.com/placeholder-$third-party
 ||kr3vinsx.com^$third-party
 ||krajiv.com^$third-party
 ||kromeleta.ru^$third-party
+||ktcdn.xyz^$third-party
 ||kug-74.com^$third-party
 ||kumpulblogger.com^$third-party
 ||kurlipush.com^$third-party
@@ -32866,6 +33014,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||l3op.info^$third-party
 ||lacerta.space^$third-party
 ||ladbrokesaffiliates.com.au^$third-party
+||ladsinfo.com^$third-party
 ||laim.tv^$third-party
 ||lakequincy.com^$third-party
 ||lakidar.net^$third-party
@@ -32904,11 +33053,12 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||leaptrade.com^$third-party
 ||leetmedia.com^$third-party
 ||legisland.net^$third-party
+||lemitsuz.net^$third-party
 ||leohd59.ru^$third-party
 ||less-css.site^$third-party
+||lessonis.com^$third-party
 ||letadnew.com^$third-party
 ||letilyadothejob.com^$third-party
-||letsadvertisetogether.com^$third-party
 ||letsgoshopping.tk^$third-party
 ||letuchiycorabl.com^$third-party
 ||letysheeps.ru^$third-party
@@ -32982,7 +33132,6 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||looneynetwork.com^$third-party
 ||loopmaze.com^$third-party
 ||loq-90.com^$third-party
-||loqara.info^$third-party
 ||lose-ads.de^$third-party
 ||loseads.eu^$third-party
 ||losomy.com^$third-party
@@ -33041,6 +33190,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||mamydirect.com^$third-party
 ||mangoads.net^$third-party
 ||mangoforex.com^$third-party
+||marapcana.online^$third-party
 ||marbil24.co.za^$third-party
 ||marfeel.com^$third-party
 ||marginalwoodfernrounddance.com^$third-party
@@ -33150,7 +33300,6 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||metavertising.com^$third-party
 ||metavertizer.com^$third-party
 ||metogo.work^$third-party
-||metricfast.com^$third-party
 ||metrics.io^$third-party
 ||meviodisplayads.com^$third-party
 ||meya41w7.com^$third-party
@@ -33249,13 +33398,14 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||moregamers.com^$third-party
 ||moreplayerz.com^$third-party
 ||morgdm.ru^$third-party
-||moritava.com^$third-party
 ||mortantse.info^$third-party
+||morydark.pw^$third-party
 ||mosaiq.io^$third-party
 ||moselats.com^$third-party
 ||motominer.com^$third-party
 ||mottnow.com^$third-party
 ||movad.net^$third-party
+||mowithlerendu.pro^$third-party
 ||mozcloud.net^$third-party
 ||mp3toavi.xyz^$third-party
 ||mpk01.com^$third-party
@@ -33268,9 +33418,6 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||msads.net^$third-party
 ||mse2v5oglm.com^$third-party
 ||msypr.com^$third-party
-||mtagmonetizationa.com^$third-party
-||mtagmonetizationb.com^$third-party
-||mtagmonetizationc.com^$third-party
 ||mtrcss.com^$third-party
 ||mujap.com^$third-party
 ||mukwonagoacampo.com^$third-party
@@ -33333,6 +33480,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||nativeleads.net^$third-party
 ||nativepu.sh^$third-party
 ||nativeroll.tv^$third-party
+||naucaips.com^$third-party
 ||nauchegy.link^$third-party
 ||navaxudoru.com^$third-party
 ||nbjmp.com^$third-party
@@ -33373,6 +33521,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||newgentraffic.com^$third-party
 ||newideasdaily.com^$third-party
 ||newjunads.com^$third-party
+||newmonads.com^$third-party
 ||newsadstream.com^$third-party
 ||newsarmor.com^$third-party
 ||newsmaxfeednetwork.com^$third-party
@@ -33400,13 +33549,16 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||nighter.club^$third-party
 ||niltutch.com^$third-party
 ||nitmus.com^$third-party
+||nittlopp.online^$third-party
 ||nization.com^$third-party
 ||njkiho.info^$third-party
 ||nkredir.com^$third-party
+||nlwy0.com^$third-party
 ||nmcdn.us^$third-party
 ||nmwrdr.net^$third-party
 ||nobleppc.com^$third-party
 ||nobsetfinvestor.com^$third-party
+||nofejectontrab.info^$third-party
 ||nompakru.click^$third-party
 ||nonpaly.ru^$third-party
 ||nonstoppartner.de^$third-party
@@ -33414,6 +33566,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||noretia.com^$third-party
 ||normkela.com^$third-party
 ||northmay.com^$third-party
+||norvalur.xyz^$third-party
 ||nothering.com^$third-party
 ||novarevenue.com^$third-party
 ||nowlooking.net^$third-party
@@ -33527,6 +33680,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||onvid.club^$third-party
 ||onwsys.net^$third-party
 ||oodode.com^$third-party
+||oodraune.com^$third-party
 ||ooecyaauiz.com^$third-party
 ||oofte.com^$third-party
 ||oopt.fr^$third-party
@@ -33573,9 +33727,11 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||otnolabttmup.com^$third-party
 ||ottomdisede.club^$third-party
 ||ouloutso.net^$third-party
+||oultuwee.net^$third-party
+||ouptoobe.net^$third-party
+||oupushee.com^$third-party
 ||ourbanners.net^$third-party
 ||ourunlimitedleads.com^$third-party
-||outlookabsorb.com^$third-party
 ||ov8pc.tv^$third-party
 ||oveld.com^$third-party
 ||overhaps.com^$third-party
@@ -33624,6 +33780,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||parding.info^$third-party
 ||pardous.com^$third-party
 ||parkingcrew.net^$third-party
+||parronnotandone.info^$third-party
 ||particizedese.club^$third-party
 ||partner-ads.com^$third-party
 ||partner.googleadservices.com^$third-party
@@ -33639,6 +33796,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||patecrafts.com^$third-party
 ||patiskcontentdelivery.info^$third-party
 ||patoris.xyz^$third-party
+||paumoogo.net^$third-party
 ||pautaspr.com^$third-party
 ||paxmedia.net^$third-party
 ||pay-click.ru^$third-party
@@ -33687,11 +33845,16 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||pgssl.com^$third-party
 ||pharmcash.com^$third-party
 ||pheedo.com^$third-party
+||pheedroh.net^$third-party
 ||pheegoab.click^$third-party
+||pheergar.com^$third-party
+||phengung.net^$third-party
 ||philbardre.com^$third-party
 ||philipstreehouse.info^$third-party
 ||philosophere.com^$third-party
 ||phonespybubble.com^$third-party
+||phudrour.net^$third-party
+||phukrovo.com^$third-party
 ||pianobuyerdeals.com^$third-party
 ||picadmedia.com^$third-party
 ||picbucks.com^$third-party
@@ -33726,8 +33889,8 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||play4k.co^$third-party
 ||playertraffic.com^$third-party
 ||playtem.com^$third-party
+||playuhd.host^$third-party
 ||playukinternet.com^$third-party
-||pleasesavemyimages.com^$third-party
 ||pleasteria.com^$third-party
 ||pleeko.com^$third-party
 ||plenomedia.com^$third-party
@@ -33756,6 +33919,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||polanders.com^$third-party
 ||polarcdn-terrax.com^$third-party
 ||polarmobile.com^$third-party
+||policityseriod.info^$third-party
 ||polluxnetwork.com^$third-party
 ||polmontventures.com^$third-party
 ||polyad.net^$third-party
@@ -33888,10 +34052,12 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||psnmail.su^$third-party
 ||psoaghie.net^$third-party
 ||psoapeez.click^$third-party
+||psoomeeg.com^$third-party
 ||ptawe.com^$third-party
 ||ptchits.com^$third-party
 ||ptmopenclose.click^$third-party
 ||ptmzr.com^$third-party
+||ptocmaux.com^$third-party
 ||ptp.lolco.net^$third-party
 ||ptp22.com^$third-party
 ||ptp24.com^$third-party
@@ -33899,6 +34065,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||pub.network^$third-party
 ||pubdirecte.com^$third-party
 ||pubgears.com^$third-party
+||pubgenius.io^$third-party
 ||pubguru.com^$third-party
 ||publicidad.net^$third-party
 ||publicityclerks.com^$third-party
@@ -33928,6 +34095,8 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||puserving.com^$third-party
 ||push-me-up.com^$third-party
 ||push2check.com^$third-party
+||pushads.biz^$third-party
+||pushagim.com^$third-party
 ||pushame.com^$third-party
 ||pushance.com^$third-party
 ||pushbaddy.com^$third-party
@@ -33941,10 +34110,12 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||pushlommy.com^$third-party
 ||pushnative.com^$third-party
 ||pushnest.com^$third-party
+||pushnevis.com^$third-party
 ||pushnice.com^$third-party
 ||pushno.com^$third-party
 ||pushservice.one^$third-party
 ||puttme.ga^$third-party
+||pw.wpu.sh^$third-party
 ||pwrads.net^$third-party
 ||pwzn9ze.com^$third-party
 ||px3792.com^$third-party
@@ -33960,6 +34131,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||q64a9ris0j.com^$third-party
 ||qadserve.com^$third-party
 ||qadservice.com^$third-party
+||qaykb.com^$third-party
 ||qdmil.com^$third-party
 ||qertewrt.com^$third-party
 ||qksrv.net^$third-party
@@ -33977,7 +34149,6 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||querylead.com^$third-party
 ||questionmarket.com^$third-party
 ||questus.com^$third-party
-||queurow.pro^$third-party
 ||quickads.net^$third-party
 ||quickcash500.com^$third-party
 ||quicktask.xyz^$third-party
@@ -34003,6 +34174,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||rapt.com^$third-party
 ||rarelly.info^$third-party
 ||rateaccept.net^$third-party
+||ratrencalrep.com^$third-party
 ||rawasy.com^$third-party
 ||rbnt.org^$third-party
 ||rcads.net^$third-party
@@ -34115,6 +34287,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||richwebmedia.com^$third-party
 ||ringtonematcher.com^$third-party
 ||ringtonepartner.com^$third-party
+||rinsouxy.com^$third-party
 ||riowrite.com^$third-party
 ||ripplead.com^$third-party
 ||riverbanksand.com^$third-party
@@ -34166,7 +34339,9 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||rwpads.com^$third-party
 ||rxthdr.com^$third-party
 ||ryminos.com^$third-party
+||ryrecdiretbet.info^$third-party
 ||s.adroll.com^$third-party
+||s20dh7e9dh.com^$third-party
 ||s2block.com^$third-party
 ||s2blosh.com^$third-party
 ||s2d6.com^$third-party
@@ -34211,6 +34386,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||scriptall.ga^$third-party
 ||scriptall.gq^$third-party
 ||scriptall.tk^$third-party
+||sdasasyydd.com^$third-party
 ||search123.uk.com^$third-party
 ||seccoads.com^$third-party
 ||secondstreetmedia.com^$third-party
@@ -34242,7 +34418,6 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||sensive.pro^$third-party
 ||senzapudore.net^$third-party
 ||septimus-kyr.com^$third-party
-||sepulchralconestogaleftover.com^$third-party
 ||sepyw.top^$third-party
 ||serialbay.com^$third-party
 ||seriend.com^$third-party
@@ -34275,14 +34450,13 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||sharegods.com^$third-party
 ||shareresults.com^$third-party
 ||sharethrough.com^$third-party
-||shipthankrecognizing.info^$third-party
-||shokala.com^$third-party
 ||shoofle.tv^$third-party
 ||shoogloonetwork.com^$third-party
 ||shopalyst.com^$third-party
 ||shoppanda.co^$third-party
 ||shoppingads.com^$third-party
 ||shopzyapp.com^$third-party
+||shouxaum.net^$third-party
 ||showcasead.com^$third-party
 ||showyoursite.com^$third-party
 ||shqads.com^$third-party
@@ -34479,9 +34653,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||strikead.com^$third-party
 ||structos.info^$third-party
 ||struq.com^$third-party
-||sturdynotwithstandingpersuasive.info^$third-party
 ||style-eyes.eu^$third-party
-||suaningrebtersed.info^$third-party
 ||subemania.com^$third-party
 ||sublimemedia.net^$third-party
 ||submissing.com^$third-party
@@ -34578,6 +34750,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||techclicks.net^$third-party
 ||technoratimedia.com^$third-party
 ||teensexgfs.com^$third-party
+||teesheel.net^$third-party
 ||telemetryverification.net^$third-party
 ||telwrite.com^$third-party
 ||tennerlist.com^$third-party
@@ -34602,7 +34775,6 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||tgtmedia.com^$third-party
 ||thaez4sh.com^$third-party
 ||thangasoline.com^$third-party
-||thankyouforadvertising.com^$third-party
 ||tharbadir.com^$third-party
 ||thdragate.info^$third-party
 ||theadgateway.com^$third-party
@@ -34610,6 +34782,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||thebannerexchange.com^$third-party
 ||thebflix.info^$third-party
 ||theequalground.info^$third-party
+||theersoa.net^$third-party
 ||thefoxes.ru^$third-party
 ||thelistassassin.com^$third-party
 ||theloungenet.com^$third-party
@@ -34617,6 +34790,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||theodosium.com^$third-party
 ||theonecdn.com^$third-party
 ||thepiratereactor.net^$third-party
+||therneserutybin.info^$third-party
 ||therubiqube.com^$third-party
 ||thewebgemnetwork.com^$third-party
 ||thewheelof.com^$third-party
@@ -34626,6 +34800,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||thoughtleadr.com^$third-party
 ||thoughtsondance.info^$third-party
 ||ti583.com^$third-party
+||tiberowheddidn.info^$third-party
 ||ticrite.com^$third-party
 ||tidaltv.com^$third-party
 ||tightexact.net^$third-party
@@ -34648,6 +34823,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||toalhjpw.com^$third-party
 ||toboads.com^$third-party
 ||todich.ru^$third-party
+||togroltu.net^$third-party
 ||tokenads.com^$third-party
 ||tolethembehisy.club^$third-party
 ||tollfreeforwarding.com^$third-party
@@ -34790,8 +34966,10 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||tubeadvertising.eu^$third-party
 ||tubemogul.com^$third-party
 ||tubereplay.com^$third-party
+||tukuterus.com^$third-party
 ||tumri.net^$third-party
 ||turboadv.com^$third-party
+||turbotraff.com^$third-party
 ||turbotraff.net^$third-party
 ||turn.com^$third-party
 ||tusno.com^$third-party
@@ -34823,7 +35001,6 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||udmserve.net^$third-party
 ||ueuerea.com^$third-party
 ||ufpcdn.com^$third-party
-||ufraton.com^$third-party
 ||ugaral.com^$third-party
 ||ughus.com^$third-party
 ||uglyst.com^$third-party
@@ -34839,6 +35016,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||ulnawoyyzbljc.ru^$third-party
 ||ultimategracelessness.info^$third-party
 ||umamdmo.com^$third-party
+||umebiggestern.club^$third-party
 ||unanimis.co.uk^$third-party
 ||unaturing.info^$third-party
 ||underclick.ru^$third-party
@@ -34860,12 +35038,12 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||untidyquestion.com^$third-party
 ||upads.info^$third-party
 ||upliftsearch.com^$third-party
-||upnorma.com^$third-party
 ||uprimp.com^$third-party
 ||upstained.com^$third-party
 ||uptimecdn.com^$third-party
 ||urbation.net^$third-party
 ||ureace.com^$third-party
+||uriqirelle.xyz^$third-party
 ||urlads.net^$third-party
 ||urlcash.net^$third-party
 ||urldelivery.com^$third-party
@@ -34987,6 +35165,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||vixnixxer.com^$third-party
 ||vkoad.com^$third-party
 ||vntsm.com^$third-party
+||voajewhe.net^$third-party
 ||voameque.com^$third-party
 ||voaroawo.net^$third-party
 ||vodexor.us^$third-party
@@ -35028,7 +35207,6 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||waframedia8.com^$third-party
 ||wagershare.com^$third-party
 ||wahoha.com^$third-party
-||wallacemaloneymindanao.info^$third-party
 ||wallstrads.com^$third-party
 ||walternsa.com^$third-party
 ||walternse.com^$third-party
@@ -35037,6 +35215,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||wantcannabis.ca^$third-party
 ||waploft.cc^$third-party
 ||waploft.com^$third-party
+||wapoawoo.net^$third-party
 ||warezlayer.to^$third-party
 ||warfacco.com^$third-party
 ||warpwrite.com^$third-party
@@ -35089,7 +35268,9 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||where.com^$third-party
 ||whistorica.info^$third-party
 ||whiteboardnez.com^$third-party
+||whizzco.com^$third-party
 ||whoads.net^$third-party
+||whs82908.com^$third-party
 ||whtsrv9.com^$third-party
 ||whukroal.net^$third-party
 ||why-outsource.net^$third-party
@@ -35106,7 +35287,6 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||wigetstudios.com^$third-party
 ||winbuyer.com^$third-party
 ||windgetbook.info^$third-party
-||windowmentaria.com^$third-party
 ||windowne.info^$third-party
 ||wingads.com^$third-party
 ||winsspeeder.info^$third-party
@@ -35129,12 +35309,14 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||worldwidemailer.com^$third-party
 ||worthathousandwords.com^$third-party
 ||worthyadvertising.com^$third-party
+||wpnjs.com^$third-party
 ||ws-gateway.com^$third-party
 ||wsp.mgid.com^
 ||wulium.com^$third-party
 ||wurea.com^$third-party
 ||wwbn.com^$third-party
 ||wwv4ez0n.com^$third-party
+||www-protection.com^$third-party
 ||wwwadcntr.com^$third-party
 ||wwwp.link^$third-party
 ||wwwpromoter.com^$third-party
@@ -35146,6 +35328,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||x8bhr.com^$third-party
 ||xad.com^$third-party
 ||xadcentral.com^$third-party
+||xameleonads.com^$third-party
 ||xaxoro.com^$third-party
 ||xcelltech.com^$third-party
 ||xcelsiusadserver.com^$third-party
@@ -35170,13 +35353,11 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||xtendadvert.com^$third-party
 ||xtendmedia.com^$third-party
 ||xubob.com^$third-party
-||xvika.com^$third-party
 ||xwwmhfbikx.net^$third-party
 ||xx00.info^$third-party
 ||xxlink.net^$third-party
 ||xyzzyxxyzzyx.com^$third-party
 ||ya88s1yk.com^$third-party
-||yaboshadi.com^$third-party
 ||yabuka.com^$third-party
 ||yadomedia.com^$third-party
 ||yambotan.ru^$third-party
@@ -35210,7 +35391,6 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||yieldselect.com^$third-party
 ||yieldtraffic.com^$third-party
 ||yieldx.com^$third-party
-||yinmyar.xyz^$third-party
 ||yiq6p.com^$third-party
 ||yjxuda0oi.com^$third-party
 ||yldbt.com^$third-party
@@ -35236,6 +35416,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||youwatchtools.com^$third-party
 ||ypreferred.com^$third-party
 ||ytsa.net^$third-party
+||yu21uy.com^$third-party
 ||yuarth.com^$third-party
 ||yucce.com^$third-party
 ||yuhuads.com^$third-party
@@ -35299,17 +35480,93 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||zyiis.net^$third-party
 ||zylstina.xyz^$third-party
 ||zypenetwork.com^$third-party
+! fiber-ads (https://blog.confiant.com/hong-kong-based-malvertiser-brokers-traffic-to-fake-antivirus-scams-over-100-million-ads-300e251eff06)
+||adminpromotion.com^
+||adsalesforce.com^
+||amazingfunnvideos.com^
+||automationeventually.com^
+||blissfulonline.com^
+||capsuledaily.com^
+||chanelets-aurning.com^
+||clickercollections.com^
+||clubpenguinclub.com^
+||commercedirections.com^
+||dialgold.com^
+||effectivelyreport.com^
+||factorcontest.com^
+||gangidance.com^
+||gladiatorbugs.com^
+||greenmentioned.com^
+||gunnersalmighty.com^
+||happylifebab.com^
+||hilltopgo.com^
+||hugexdeal.com^
+||includeinthebox.com^
+||jasonsvid.com^
+||justmarriedvideo.com^
+||libreriamedina.com^
+||magararepublic.com^
+||manorparty.com^
+||menuexamples.com^
+||myaarzoo.com^
+||naughtyxparty.com^
+||oddheels.com^
+||pennyotcstock.com^
+||recentphenomenon.com^
+||requestingreview.com^
+||robovoiz.com^
+||romeoforum.com^
+||safeonlinesites.com^
+||salemyticket.com^
+||scaryheels.com^
+||showgardener.com^
+||softxbutt.com^
+||studiolineworks.com^
+||tacchisexy.com^
+||taodropship.com^
+||thegreenzoneblog.com^
+||ticktockhealth.com^
+||topgreatxoffers.com^
+||trackmackweldon.com^
+||trafficshirts.com^
+||travelstool.com^
+||upcum.com^
+||wallpapersfacts.com^
+||wholesomehealthshop.com^
+||wonderfulproductives.com^
+||yukongoldinfo.com^
+||yygoshopping.com^
 ! Document blocks
+||arrlnk.com^$document
 ||cbbp1.com^$document
+||cdaz.icu^$document
 ||clk-can.com^$document
 ||clk-sec.com^$document
 ||dianomi.com^$document
+||dilruwha.net^$document
+||discoverredirect.com^$document
+||dolohen.com^$document
+||edchargina.pro^$document
 ||feadrope.net^$document
 ||flix16.com^$document
+||gdmconvtrck.com^$document
+||hutrcksp.com^$document
+||iyfnzgb.com^$document
 ||mellodur.net^$document
 ||oiycak.com^$document
 ||otnolabttmup.com^$document
+||parronnotandone.info^$document
+||premium-members.com^$document
+||redirectgang.com^$document
+||rsalcdp.com^$document
+||rtmark.net^$document
+||rtpdn10.com^$document
+||runtnc.net^$document
+||securesmrt-dt.com^$document
+||stream-all.com^$document
 ||syndication.exosrv.com^$document
+||trackerislive.com^$document
+||tukuterus.com^$document
 ||yvsystem.com^$document
 ! IP addresses
 ||104.154.$document
@@ -35343,7 +35600,6 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||bravome.pro^$third-party
 ||brazienting.co^$third-party
 ||breeringarify.co^$third-party
-||brigenlies.pro^$third-party
 ||broced.co^$third-party
 ||buonome.pro^$third-party
 ||busions.com^$third-party
@@ -35374,7 +35630,6 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||donecooler.com^$third-party
 ||dustumbs.pro^$third-party
 ||elepocial.pro^$third-party
-||exchange.automoc.net^$third-party
 ||exclusivecpms.com^$third-party
 ||explanse.co^$third-party
 ||explater.net^$third-party
@@ -35919,7 +36174,6 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||bfb487de1f2da5c.com^$third-party
 ||bfc70a51929fff2d7fe.com^$third-party
 ||bfe4e6d364be199.com^$third-party
-||bodelen.com^$third-party
 ||bwknu1lo.top^$third-party
 ||c0afd4609c303.com^$third-party
 ||c10ed2b8b417880.com^$third-party
@@ -35957,7 +36211,6 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||chainwalladsy.com^$third-party
 ||charmour.club^$third-party
 ||chauksoa.net^$third-party
-||coinsicmp.com^$third-party
 ||constintptr.com^$third-party
 ||coostuni.com^$third-party
 ||culsauwou.com^$third-party
@@ -36036,7 +36289,6 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||efd3b86a5fbddda.com^$third-party
 ||ekoocmujairt.com^$third-party
 ||ethikuma.link^$third-party
-||extra33.com^$third-party
 ||f01ed651eca.com^$third-party
 ||f18a35cc33ee29a.com^$third-party
 ||f26f3cbe225289a0947.com^$third-party
@@ -36096,13 +36348,10 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||amadagasca.com^$third-party
 ||anyonemyth.com^$third-party
 ||babyboomboomads.com^$third-party
-||bestforexplmdb.com^$third-party
 ||brinein.com^$third-party
 ||bristlyapace.com^$third-party
 ||broomboxmain.com^$third-party
-||cashinme.com^$third-party
 ||challengedeprave.com^$third-party
-||clickpartoffon.xyz^$third-party
 ||comegarage.com^$third-party
 ||completeexecutor.com^$third-party
 ||curriculture.com^$third-party
@@ -36127,16 +36376,15 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||g383912402.com^$third-party
 ||g3938452447.com^$third-party
 ||g4058683381.com^$third-party
+||galaks.io^$third-party
 ||glxfls.com^$third-party
 ||gmyvids.com^$third-party
 ||helpclause.com^$third-party
 ||humparsi.com^$third-party
 ||injuredcandy.com^$third-party
-||intangibleconcordant.com^$third-party
 ||jackettrain.com^$third-party
 ||katurars.com^$third-party
 ||letsdoarbitrage.com^$third-party
-||linkforyoud.com^$third-party
 ||lutereum.com^$third-party
 ||lyoniaancony.com^$third-party
 ||makemyvids.com^$third-party
@@ -36181,6 +36429,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||turngrind.com^$third-party
 ||uncyane.com^$third-party
 ||windowmentaria.com^$third-party
+||xilbalar.com^$third-party
 ||zinidge.com^$third-party
 ! Tag adservers
 ||1el-1el-fie.com^$third-party
@@ -36195,7 +36444,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||3delllwrite.com^$third-party
 ||3el-3el-fie.com^$third-party
 ||4dtrk.com^$third-party
-||addroplet.com^$third-party
+||adqy6rzwcs.com^$third-party
 ||badtopwitch.work^$third-party
 ||baletingo.com^$third-party
 ||bandelcot.com^$third-party
@@ -36256,11 +36505,11 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||lmn-pou-win.com^$third-party
 ||lnkrdr.com^$third-party
 ||meepwrite.com^$third-party
+||muqson0kgr.com^$third-party
 ||netrosol.net^$third-party
 ||new-new-years.com^$third-party
 ||new17write.com^$third-party
 ||newsadst.com^$third-party
-||normkela.com^$third-party
 ||nyacampwk.com^$third-party
 ||otnolatrnup.com^$third-party
 ||parwrite.com^$third-party
@@ -36555,7 +36804,6 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||mg6ikpbhco.com^$third-party
 ||mh9dskj8jg.com^$third-party
 ||mhbdezpwdq.com^$third-party
-||modulepush.com^$third-party
 ||mpuqvoa.com^$third-party
 ||mqpx4.com^$third-party
 ||mtvp05j.com^$third-party
@@ -36577,7 +36825,6 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||pesbqkopdm.com^$third-party
 ||provalist.info^$third-party
 ||ptarepjx.com^$third-party
-||puhtml.com^$third-party
 ||pujj652hkm.com^$third-party
 ||pussl10.com^$third-party
 ||pussl3.com^$third-party
@@ -36694,3425 +36941,742 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||zu4l167j77.com^$third-party
 ! popads.net
 ||aabmxezph.com^$third-party
+||aacgeuvaoqbw.com^$third-party
+||aadbobwqgmzi.com^$third-party
+||aaeqlxdgx.bid^$third-party
 ||aagmbroxruno.com^$third-party
+||aahfcroigwso.com^$third-party
+||aajychvi.bid^$third-party
+||aanvxbvkdxph.com^$third-party
+||aaomstbnbiqo.com^$third-party
+||aapxtnrhq.bid^$third-party
+||aaqpajztftqw.com^$third-party
+||aariczayhpo.com^$third-party
 ||aarwxotc.com^$third-party
+||aaslmqzce.bid^$third-party
+||aasopqgmzywa.com^$third-party
+||aatfnptblbxpuy.bid^$third-party
+||aatmytrykqhi.com^$third-party
 ||aayaknbn.com^$third-party
+||aazwugtom.com^$third-party
+||abaujsqnndg.bid^$third-party
 ||abbahoxgss.com^$third-party
+||abbowtxibib.com^$third-party
+||abekjzzhfbr.com^$third-party
 ||abfcfxfkzmiqht.com^$third-party
+||abunmrqsbfn.bid^$third-party
+||abuuvohpzlcrp.bid^$third-party
+||abxlmhllf.com^$third-party
+||abyvhqmfnvih.com^$third-party
+||acacexjsh.com^$third-party
 ||acbrupozabmdc.com^$third-party
 ||acdektqffm.com^$third-party
 ||acduswfvyjylzq.com^$third-party
 ||achsijkc.com^$third-party
+||acjmkenepeyn.com^$third-party
 ||aclhagvngkjf.com^$third-party
+||aclsqdpgeaik.com^$third-party
 ||aclwlkyzxxhn.com^$third-party
+||acnsavlosahs.com^$third-party
+||acpxgmzozlxtbj.bid^$third-party
 ||acrsgxeah.com^$third-party
 ||acvxsptoqh.com^$third-party
+||acwswfbyhtsf.com^$third-party
 ||acwyoynw.com^$third-party
+||acxujxzdluum.com^$third-party
 ||adakgpoi.com^$third-party
 ||addgfxnb.com^$third-party
 ||adeyujimmmh.com^$third-party
 ||adfoitjumerzge.com^$third-party
+||adfpkxvaqeyj.com^$third-party
+||adgsfoxoavmc.com^$third-party
+||admlqqewbede.com^$third-party
+||adofuokjj.bid^$third-party
+||adqvauwe.com^$third-party
+||adrtgbebgd.bid^$third-party
+||adtbomthnsyz.com^$third-party
+||adtikimdtfbb.com^$third-party
+||adudzlhdjgof.com^$third-party
+||aduobooydxr.com^$third-party
 ||advmaiotg.com^$third-party
 ||adxpddpc.com^$third-party
+||aebhdrkiybgy.com^$third-party
 ||aeeefzfuk.com^$third-party
+||aeezeynmam.bid^$third-party
+||aefqdgklyu.com^$third-party
 ||aefvxtue.com^$third-party
 ||aeizbvtknp.com^$third-party
+||aekduylxcmlevs.bid^$third-party
+||aemhabst.bid^$third-party
 ||aemxvcqi.com^$third-party
+||aenrqpnfmdogf.com^$third-party
 ||aeobzaii.com^$third-party
+||aepwqsajypyti.com^$third-party
+||aepwtbusoofzw.com^$third-party
+||aerkxydrptnv.com^$third-party
+||aerqvywe.com^$third-party
+||aestldhxdqlo.com^$third-party
+||aeuiazspafmbu.com^$third-party
+||aeunorkjuqtn.com^$third-party
 ||aewzmsurtab.com^$third-party
+||aeyjbtwdf.bid^$third-party
+||aezeluusbdajjx.com^$third-party
+||afbfoxmwzlqa.com^$third-party
+||afdyfxfrwbfy.com^$third-party
+||afedispdljgb.com^$third-party
 ||afeeknuueaztxt.com^$third-party
 ||afeuvqrsswz.com^$third-party
 ||afgbvhocfvpm.com^$third-party
+||aflcdijgmr.bid^$third-party
 ||afnrmofoljod.com^$third-party
+||afpisdddjik.bid^$third-party
+||afqvtomlqjioeo.com^$third-party
+||afqwfxkjmgwv.com^$third-party
+||afruetdxrbxz.com^$third-party
 ||afxtcajgtzcugb.com^$third-party
+||afyqzjxzuupmz.bid^$third-party
 ||afzkqajwcbub.com^$third-party
 ||afzoyaquhjltdd.com^$third-party
+||agegefpkbll.bid^$third-party
+||agffpcpi.bid^$third-party
 ||agfqcndiugnr.com^$third-party
+||agfwzptrqb.bid^$third-party
+||aggntknflhal.com^$third-party
 ||aggpfmdtzf.com^$third-party
+||agiuvdbcxdirh.com^$third-party
+||agiuzlmavpnlb.com^$third-party
+||aglyzutlhnbtgu.bid^$third-party
+||agnznxaqd.com^$third-party
+||agospkfp.bid^$third-party
+||agpnzrmptmos.com^$third-party
 ||agqguxbm.com^$third-party
 ||agrxsdujnh.com^$third-party
+||agshzkcsvoou.bid^$third-party
+||agvinhvex.com^$third-party
+||agwsneccrbda.com^$third-party
+||agzupwcefbjol.bid^$third-party
+||ahfmyeuwlhp.bid^$third-party
+||ahgekvzwjn.com^$third-party
+||ahjljmxfxuet.com^$third-party
+||ahjwkwugxvznxv.com^$third-party
+||ahkilcrublxn.bid^$third-party
+||ahkpdnrtjwat.com^$third-party
+||ahllgtevqrsh.com^$third-party
+||ahstrelgnh.com^$third-party
+||ahtkajcs.com^$third-party
 ||ahuivddkvrrebo.com^$third-party
 ||ahuosyyqprt.com^$third-party
+||ahvnvtxbk.bid^$third-party
+||ahwjxktemuyz.com^$third-party
+||ahyuzjgukqyd.com^$third-party
+||ahzybvwdwrhi.com^$third-party
 ||aibcqjlvxxd.com^$third-party
+||aicrgbnswhc.bid^$third-party
+||aigysycrmuoetk.com^$third-party
+||aiiaqehoqgrj.com^$third-party
 ||aiiukvzjtsc.com^$third-party
 ||aikdakxoc.com^$third-party
+||aiokvzsq.com^$third-party
+||aionvpexcmm.com^$third-party
+||aioxvilwpg.bid^$third-party
+||aiprvqqnhm.com^$third-party
+||airfhtyo.bid^$third-party
 ||aitdwhmcvlm.com^$third-party
+||aiwznhifgkdqvy.com^$third-party
+||aiypulgy.com^$third-party
 ||aizopowmtnho.com^$third-party
+||ajaeihzlcwvn.com^$third-party
+||ajcsjktzlqh.com^$third-party
+||ajfziqehnwvz.com^$third-party
+||ajgffcat.com^$third-party
 ||ajizjpjkrnh.com^$third-party
+||ajkjnofeqrra.bid^$third-party
+||ajmggjgrardn.com^$third-party
 ||ajmwuweeif.com^$third-party
+||ajmyrtdiwvg.bid^$third-party
 ||ajoaorexnieym.com^$third-party
+||ajocbplhzcvr.bid^$third-party
+||ajrwmjdbey.com^$third-party
 ||ajttqxeqg.com^$third-party
+||ajuegtbkqnh.com^$third-party
+||ajxftwwmlinv.com^$third-party
+||ajxwyowuylhos.bid^$third-party
 ||ajzdkkzv.com^$third-party
+||ajzxdeslpbnhp.bid^$third-party
+||akbeyfcu.com^$third-party
+||akbiokbinnzh.com^$third-party
 ||akcdinzvcenhjh.com^$third-party
 ||akdzimverrss.com^$third-party
+||akgustnmy.com^$third-party
+||akhlkkdrxwav.com^$third-party
 ||akmihtdbbz.com^$third-party
+||aknrvuahd.bid^$third-party
+||akoeurmzrqjg.com^$third-party
+||akovcxrklaq.bid^$third-party
+||akrzgxzjynpi.com^$third-party
+||akviqfqbwqqj.com^$third-party
+||akvtmvoolwlm.bid^$third-party
+||akwajlcoap.com^$third-party
+||akxsrsdbursfpx.bid^$third-party
 ||akyscwwwttk.com^$third-party
+||akzgmbembk.com^$third-party
+||akzqosxbzl.bid^$third-party
 ||akzvxmjnubq.com^$third-party
+||aladbvddjsxf.com^$third-party
+||alajwtqyw.com^$third-party
+||alasdzdnfvtj.com^$third-party
+||aldaobpuhvl.com^$third-party
+||algkebjdgafa.com^$third-party
+||algnnojsdr.com^$third-party
 ||algrizej.com^$third-party
+||alhpqmefnwkxtn.com^$third-party
+||alidnquxirv.bid^$third-party
 ||alikuvxxwy.com^$third-party
 ||aljsuubo.com^$third-party
+||aljwnypxzw.com^$third-party
 ||alkagrkgvltzlk.com^$third-party
 ||allnvbtrtpku.com^$third-party
+||alnisdrmhs.bid^$third-party
 ||alvdtjrb.com^$third-party
+||alvivigqrogq.com^$third-party
+||alxetzfhlzekv.bid^$third-party
+||alxzes.com^$third-party
+||alyhlhyhaetbk.com^$third-party
 ||amaecylce.com^$third-party
+||amaqcgrrmedi.bid^$third-party
 ||amauzaqp.com^$third-party
+||ambqphwf.com^$third-party
+||amdhlyqfy.bid^$third-party
+||amgkkjgjktml.com^$third-party
+||amhpbhyxfgvd.com^$third-party
+||amjbzzicysu.bid^$third-party
+||amjrfmhtmoyan.com^$third-party
+||amkwvxhw.com^$third-party
 ||amlcscfr.com^$third-party
+||amlyrket.bid^$third-party
+||ammqwpksb.bid^$third-party
+||ammuburyqlhsjx.bid^$third-party
+||amnpmitevuxx.com^$third-party
+||amnrbviujof.com^$third-party
+||ampnkoudpnd.bid^$third-party
+||amqcdbles.com^$third-party
+||amqtbshegbqg.com^$third-party
 ||amrfscxvdvfvpa.com^$third-party
+||amwupsihqfewgr.com^$third-party
+||anasjdzutdmv.com^$third-party
 ||aneqmscervl.com^$third-party
+||anfjrxbxbar.bid^$third-party
+||angtqemchz.bid^$third-party
+||anjjyewywjw.bid^$third-party
 ||anjqxwvqfnri.com^$third-party
+||ankbmqtt.com^$third-party
+||ankcnflupb.com^$third-party
+||anleqthwxxns.com^$third-party
+||anluecyopslm.com^$third-party
+||anmvuuhgo.com^$third-party
+||anogjkubvdfe.com^$third-party
+||anoufpjmkled.com^$third-party
 ||anpwsppugpu.com^$third-party
+||anqnimezkdjm.com^$third-party
+||antrtrtyzkhw.com^$third-party
+||anvagsqctxsaz.bid^$third-party
+||anvskelwpvvmtg.bid^$third-party
+||anypbbervqig.com^$third-party
+||anyuwksovtwv.com^$third-party
+||anyyqhtebsit.com^$third-party
+||aodqhrwbaky.com^$third-party
+||aofxqchnbtae.bid^$third-party
+||aohonqhbhuljz.com^$third-party
 ||aomegwesrfbvxe.com^$third-party
+||aominpzhzhwj.com^$third-party
+||aomvdhxvblfp.com^$third-party
 ||aonxktnn.com^$third-party
+||aoqpvhstmc.bid^$third-party
+||aoqviogrwckf.com^$third-party
+||aoqvovzrtlpn.bid^$third-party
 ||aorzglux.com^$third-party
 ||aoshrcptugsjd.com^$third-party
+||aotrcqegtfhlaw.bid^$third-party
+||aoukclebpcb.com^$third-party
+||aovajfmsy.com^$third-party
+||aoxkyvcmgr.bid^$third-party
+||aoxntgxf.bid^$third-party
+||aoyfhtarolgemn.bid^$third-party
+||apbwldhfuvnk.com^$third-party
+||apcugpxy.com^$third-party
 ||apddozcgdh.com^$third-party
+||apfbtiqdly.bid^$third-party
 ||apfmwcktbj.com^$third-party
+||apgjczhgjrka.com^$third-party
+||aphjbgth.com^$third-party
 ||apiryrkxkhil.com^$third-party
 ||aplfkrppjsutf.com^$third-party
+||apmgzzaej.bid^$third-party
+||apmkcdsnv.bid^$third-party
+||aprddnfuzc.bid^$third-party
 ||apscxogwydnkx.com^$third-party
 ||apsntakwzycu.com^$third-party
+||aptaeabkg.com^$third-party
+||apuorlaqiscu.bid^$third-party
+||apwtlkkd.bid^$third-party
+||apzbwicuuujw.bid^$third-party
+||apzzvvztziqex.bid^$third-party
+||aqdrzqsuxxvd.com^$third-party
+||aqeukceruxzd.com^$third-party
 ||aqfpqzxzk.com^$third-party
+||aqjdigkqvmakz.com^$third-party
+||aqkujuggztyn.bid^$third-party
+||aqlvpnfxrkyf.com^$third-party
+||aqocbcnfxkuw.com^$third-party
+||aqodwthjaq.com^$third-party
+||aqornnfwxmua.com^$third-party
 ||aqotbmnzra.com^$third-party
 ||aqrglffxw.com^$third-party
+||aqryyhyzjveh.com^$third-party
+||aqsijnkyauxur.bid^$third-party
+||aqsuhqqgv.bid^$third-party
+||aqtnrnuhqfaf.bid^$third-party
 ||aquhcfvu.com^$third-party
 ||aqussxtpjfelp.com^$third-party
+||aqyhsqhggq.com^$third-party
+||aragvjeosjdx.com^$third-party
+||arawegnvvufy.com^$third-party
 ||arcfwcxi.com^$third-party
+||arfttojxv.com^$third-party
 ||arjgnqlsdo.com^$third-party
 ||arkhamxojvr.com^$third-party
+||arllvzkoh.com^$third-party
+||arloxpiosxzjw.bid^$third-party
+||arprijxrml.bid^$third-party
+||arpucyhlmes.com^$third-party
+||arqxpopcywrr.bid^$third-party
+||artnbnbam.com^$third-party
 ||artsdvaguur.com^$third-party
+||artucripkzu.com^$third-party
 ||arwlvjqzxxnftz.com^$third-party
+||arxerlxllv.bid^$third-party
+||aryufuxbmwnb.com^$third-party
 ||asbqyhrpty.com^$third-party
 ||asdtwttky.com^$third-party
+||asecxggulyrf.com^$third-party
+||ashwlrtiazee.com^$third-party
 ||askywtrk.com^$third-party
+||asmvccgoy.bid^$third-party
+||asotnnwspw.bid^$third-party
 ||aspxbwteth.com^$third-party
+||asqamasz.com^$third-party
 ||asqbwneriyvur.com^$third-party
+||asqpniwvxea.com^$third-party
 ||asrjtcddksm.com^$third-party
 ||asrjxxzxmxy.com^$third-party
 ||astpvgpwbewx.com^$third-party
+||aszdmbftkccdkj.com^$third-party
 ||aszyzwbjs.com^$third-party
+||ataufekxogxr.com^$third-party
+||atcyboopajyp.com^$third-party
 ||atczxgxuxloqf.com^$third-party
+||atebqbjh.bid^$third-party
+||atijsiwpbrvtm.bid^$third-party
+||atjgtndhvbescp.bid^$third-party
+||atkkkyhyxemut.bid^$third-party
 ||atrcoikdyagv.com^$third-party
+||atryzvsn.com^$third-party
+||atzrsfweb.bid^$third-party
+||aubmolods.com^$third-party
+||aubrythgmge.bid^$third-party
 ||audersmi.com^$third-party
+||aueceijyp.bid^$third-party
+||aufyuiavvkf.bid^$third-party
 ||aultemeztokc.com^$third-party
 ||authmoumrl.com^$third-party
+||autkmgrbdlbj.com^$third-party
 ||auwqdpbyl.com^$third-party
 ||auyyklnpj.com^$third-party
+||avbnzstidjh.com^$third-party
+||avdfcctzwfdk.com^$third-party
+||avditmiohvtq.bid^$third-party
+||avefyjulko.bid^$third-party
+||avfymwmwpky.com^$third-party
 ||avjxftprif.com^$third-party
 ||avkigyhrazah.com^$third-party
+||avlysyhuvxebl.bid^$third-party
+||avokvnpqunol.bid^$third-party
 ||avoljljeif.com^$third-party
 ||avonnfckdeqeyr.com^$third-party
 ||avpgdzdesjnt.com^$third-party
+||avptczdpdh.bid^$third-party
+||avrdpbiwvwyt.com^$third-party
 ||avrdrpwt.com^$third-party
+||avvfgiytnir.com^$third-party
+||avvlnbpwpemfl.bid^$third-party
 ||avyrpwvm.com^$third-party
+||avzkjvbaxgqk.com^$third-party
+||awaeswvqd.bid^$third-party
+||awbvqznqxysjjw.com^$third-party
+||awfjqdhcuftd.com^$third-party
+||awgdgpawhwgi.bid^$third-party
 ||awgsmfzrslcp.com^$third-party
+||awgyhiupjzvu.com^$third-party
 ||awhxbiqf.com^$third-party
+||awjgketgdpzqxo.bid^$third-party
+||awjkbnhylulcl.bid^$third-party
+||awogbtinorwx.com^$third-party
 ||awpxjguq.com^$third-party
+||awrspmpj.com^$third-party
 ||awrxkucpfbsq.com^$third-party
+||awsatstb.com^$third-party
+||awvrvqxq.com^$third-party
+||awvuhwqyimgd.com^$third-party
+||awxjpkxoqfwaj.bid^$third-party
+||awzdbycpiwncrp.com^$third-party
+||axaggthnkquj.com^$third-party
+||axbouiklwghehw.com^$third-party
+||axbpixbcucv.bid^$third-party
+||axbsdoysiogrrc.bid^$third-party
 ||axcqasdiots.com^$third-party
+||axeobgnsk.com^$third-party
+||axfihweksrgor.com^$third-party
+||axfkfstrbacx.com^$third-party
 ||axfsqwyidpml.com^$third-party
 ||axgkizsmtgks.com^$third-party
+||axglltqwtmnl.com^$third-party
+||axhkxqmrqxf.bid^$third-party
+||axjnnlrc.bid^$third-party
 ||axjxdtnguuyqr.com^$third-party
+||axkiznybznfa.bid^$third-party
 ||axmxarqxbkc.com^$third-party
+||axsczaklngkxx.com^$third-party
 ||axvabgnr.com^$third-party
+||axzrxkkklakka.com^$third-party
 ||aycwvgrra.com^$third-party
+||ayhdwulehfdwn.com^$third-party
+||ayjebauqdrys.com^$third-party
+||ayjfodxqmykn.com^$third-party
 ||aykgxavgrooa.com^$third-party
+||aykosfkx.bid^$third-party
+||ayloqdal.bid^$third-party
+||ayozhcgcsyun.com^$third-party
+||ayyslqwrmoygf.com^$third-party
+||ayyvsbbbav.com^$third-party
 ||ayyxveilslz.com^$third-party
+||azbdbtsmdocl.com^$third-party
 ||azdhfnoojvpuvr.com^$third-party
+||azditojzcdkc.com^$third-party
+||azebikcvhtysn.com^$third-party
+||azeozrjk.com^$third-party
+||azfmulmqcz.bid^$third-party
 ||azfoibmukpwz.com^$third-party
 ||azgmbqhlr.com^$third-party
 ||azgwyeyjufdqc.com^$third-party
 ||azgyimccolyyo.com^$third-party
+||azgyzdjexcxg.com^$third-party
+||azhdgruuvllzxg.com^$third-party
 ||azihmmkagcey.com^$third-party
+||azkvcgzjsrmk.com^$third-party
+||azlbmpidrvnoi.bid^$third-party
 ||aznfyqgrbgy.com^$third-party
+||azofucrzkkaa.com^$third-party
+||azqmmfhmfnpsvb.bid^$third-party
+||azroydhgqcfv.com^$third-party
+||azzvkcavtgwp.com^$third-party
+||badgmvhtvryg.bid^$third-party
+||baerxupsjjegb.com^$third-party
+||bagoojzsqygg.com^$third-party
 ||bahnjhnrcdwi.com^$third-party
+||baiaclwdpztd.com^$third-party
+||bajofdblygev.com^$third-party
+||bakaqddxhhsid.com^$third-party
+||bakdsoarxjab.com^$third-party
+||bakjtxvku.bid^$third-party
 ||banuhqxbc.com^$third-party
+||baommitouduxo.bid^$third-party
 ||baphruesqm.com^$third-party
 ||bardogjvsa.com^$third-party
+||batigfkcbwpb.com^$third-party
+||bauffnmtou.com^$third-party
 ||bavftcgoapga.com^$third-party
+||bayvlsmaahou.com^$third-party
 ||bbackcssmwam.com^$third-party
+||bbbrhcxtdkfui.bid^$third-party
 ||bbfasycx.com^$third-party
+||bbheuxcancwj.com^$third-party
 ||bbillwowlfur.com^$third-party
+||bbitetuncmwfjd.com^$third-party
+||bbjlsdqhpbuqaspgjyxaobmpmzunjnvqmahejnwwvaqbzzqodu.com^$third-party
+||bbkxmpgjwo.bid^$third-party
+||bblznptpffqc.com^$third-party
+||bbmkyxvxiw.bid^$third-party
+||bbmptlckxgi.com^$third-party
 ||bbnnjjom.com^$third-party
+||bboemhlddgju.com^$third-party
+||bbopkapcgonb.com^$third-party
+||bbqipbsg.bid^$third-party
+||bbqqjejhd.bid^$third-party
+||bbtlombqjr.bid^$third-party
+||bbuyirgucsbfwt.com^$third-party
 ||bbxaumvpzqpunx.com^$third-party
+||bbzwbxchqgph.com^$third-party
 ||bcajjtbzmdrl.com^$third-party
+||bcgcvepi.com^$third-party
+||bckmtidcnrobwh.bid^$third-party
+||bckwfsvdgfjw.com^$third-party
 ||bclizbwet.com^$third-party
+||bcnhnekodmdniu.com^$third-party
+||bcnikicdi.bid^$third-party
+||bcoavtimgn.bid^$third-party
 ||bcobmmozfan.com^$third-party
 ||bcqrmuwbvxi.com^$third-party
+||bcxdjxlassr.bid^$third-party
+||bcxfshnxaiqemn.bid^$third-party
 ||bcxronvqkwe.com^$third-party
+||bczvulovuap.com^$third-party
 ||bczxmlqcugwgs.com^$third-party
+||bdafhnltyxlw.com^$third-party
+||bddaxoaaco.bid^$third-party
+||bddfeltry.bid^$third-party
+||bdggxjonzbmq.com^$third-party
 ||bdhxpxohwssdfd.com^$third-party
+||bdisnqwfcq.com^$third-party
+||bdkduogsu.bid^$third-party
 ||bdnfszdqwaduv.com^$third-party
+||bdotqoqzxauf.com^$third-party
+||bdozkocgkljj.com^$third-party
+||bdrfwkzu.bid^$third-party
 ||bdtmbiezv.com^$third-party
 ||bdtwxreri.com^$third-party
 ||bdyhvguiq.com^$third-party
+||bdyzewccsqpw.com^$third-party
+||bebufuspldzh.com^$third-party
+||bebxxrgjigz.com^$third-party
 ||beelzgkdjr.com^$third-party
+||beeseggjfru.bid^$third-party
+||befxqicnz.bid^$third-party
+||begbkbqywd.bid^$third-party
+||beghfkrygvxp.com^$third-party
 ||begnsbnjegnolq.com^$third-party
+||begxhuqfrx.bid^$third-party
+||behjgnhniasz.com^$third-party
+||behybmunweid.com^$third-party
+||bejotlmrijxvor.com^$third-party
 ||bekiruvppl.com^$third-party
+||bektvxxfv.bid^$third-party
+||beufosew.bid^$third-party
+||bewcmime.com^$third-party
+||bewovdhiubnk.com^$third-party
+||bewumuhax.bid^$third-party
 ||bexbpzultczaa.com^$third-party
+||bexogxapbqict.bid^$third-party
+||bezcmsrzx.com^$third-party
+||bezqvpliexxtfw.com^$third-party
+||bfcazxhkofa.club^$third-party
+||bfdihioj.com^$third-party
+||bfhavmgufvhn.com^$third-party
 ||bfhlxjwc.com^$third-party
+||bfidvcsuazwy.com^$third-party
+||bfkpzjqpawfu.com^$third-party
+||bflcuvtyffao.bid^$third-party
 ||bfmrffluuazwn.com^$third-party
+||bfpzhrzcvs.bid^$third-party
 ||bfrhqyaxtxbq.com^$third-party
+||bfsssvkowvh.com^$third-party
 ||bftmphbwpwnnt.com^$third-party
 ||bfxachbubcki.com^$third-party
+||bfzuuuuhvexxs.com^$third-party
+||bgarilrzlgez.com^$third-party
+||bgbdzfeeoko.com^$third-party
+||bgbmtqzoc.bid^$third-party
 ||bgchxhhzdee.com^$third-party
+||bgcsojmtgdrv.com^$third-party
+||bgdacrgsnt.com^$third-party
 ||bgfdrngowyy.com^$third-party
+||bgfgaduyvocz.com^$third-party
+||bgibeluywjhgb.com^$third-party
 ||bgibrhkn.com^$third-party
 ||bgiiubagsuvv.com^$third-party
+||bgitczbd.com^$third-party
+||bglnzzsgigbto.com^$third-party
 ||bgmgyuzcfrujc.com^$third-party
+||bgpxrwjrbsjb.com^$third-party
+||bgqddlvq.com^$third-party
+||bgrojtcdymmcdr.com^$third-party
+||bgtmceqoipodkv.com^$third-party
+||bguaeoakgmrw.com^$third-party
+||bgvexbybxxbcao.com^$third-party
+||bgxjypaeyocjy.bid^$third-party
+||bgybufwnfxkcr.bid^$third-party
 ||bgzyppwk.com^$third-party
+||bhbkfoybvrl.bid^$third-party
+||bhcpmowwxwbv.com^$third-party
+||bhejerqgrtlq.com^$third-party
+||bhfpvqdmjarlk.com^$third-party
 ||bhfuoayzqqv.com^$third-party
+||bhggbeynqhwm.bid^$third-party
+||bhjhijisulwl.com^$third-party
+||bhklyaazmxq.com^$third-party
+||bhlusdvadp.com^$third-party
+||bhmenavkijeufq.bid^$third-party
+||bhmenywkptbkga.bid^$third-party
+||bhmqoolzgxnp.com^$third-party
 ||bhmzjxrf.com^$third-party
 ||bhpxcsmvkqgd.com^$third-party
+||bhuewuodwz.bid^$third-party
+||bhwpdezzduthrp.com^$third-party
+||bhyqllgtzjee.com^$third-party
+||bhyyevhmha.com^$third-party
+||biavgmpz.com^$third-party
+||bictxzszwkwghn.com^$third-party
+||bidfppkjo.com^$third-party
+||biftbtajfs.bid^$third-party
+||bihzqdflxeelc.com^$third-party
 ||biijdpauyvf.com^$third-party
+||bijfzvbtwhvf.com^$third-party
 ||bijkemraly.com^$third-party
 ||bikuetrh.com^$third-party
 ||biliqpvehf.com^$third-party
 ||bimwswreljucxa.com^$third-party
+||binasmdul.com^$third-party
 ||binullxzwnsqws.com^$third-party
+||bircgizd.com^$third-party
+||birpidnl.com^$third-party
 ||birslhmnnc.com^$third-party
+||bisvljlzmai.com^$third-party
 ||biupcyhpmjazv.com^$third-party
+||bivujadpvk.com^$third-party
+||biwjfwhxoy.bid^$third-party
 ||bixolsoqluvzpu.com^$third-party
+||bjceodmwesmbth.com^$third-party
+||bjcunwelpd.com^$third-party
+||bjdfckchzsa.bid^$third-party
+||bjenzpojtgvo.club^$third-party
+||bjfxcvebjrcuce.bid^$third-party
+||bjgavencynifm.bid^$third-party
+||bjgaxcstxlvm.bid^$third-party
+||bjjjbwexvkotj.com^$third-party
 ||bjkejdex.com^$third-party
+||bjkfmvhygpub.com^$third-party
+||bjknjsfrevt.bid^$third-party
+||bjkookfanmxx.bid^$third-party
+||bjmrnfwcoqp.bid^$third-party
+||bjnxegsgre.com^$third-party
 ||bjofqnbtokzz.com^$third-party
+||bjpktmjdxqpl.com^$third-party
+||bjshimgqbc.com^$third-party
+||bjswchnxfoui.bid^$third-party
+||bjvynucz.bid^$third-party
+||bjxrjybjnh.com^$third-party
+||bjzcyqezwksznxxhscsfcogugkyiupgjhikadadgoiruasxpxo.com^$third-party
+||bjzegkfv.com^$third-party
+||bkedsknecp.com^$third-party
+||bkeueifcqeicli.bid^$third-party
+||bkfilgmhnnbq.com^$third-party
+||bkgesylgvrgf.com^$third-party
+||bkggsumw.bid^$third-party
+||bkmmlcbertdbselmdxpzcuyuilaolxqfhtyukmjkklxphbwsae.com^$third-party
+||bkmtspywevsk.com^$third-party
+||bkqksceiw.bid^$third-party
 ||bksbcawzviwcw.com^$third-party
+||bkscqpflg.com^$third-party
+||bkshpuspj.bid^$third-party
+||bktrlzpxcft.bid^$third-party
 ||bkuubwuarrkxk.com^$third-party
+||bkuzcrcdh.bid^$third-party
+||bkvrdeiqtgan.bid^$third-party
 ||bkvwnbkq.com^$third-party
+||bkxkodsmrnqd.com^$third-party
+||blcmacswwmqv.com^$third-party
 ||blgrwhaww.com^$third-party
+||blkivkplpn.com^$third-party
+||blnxyqdnsl.bid^$third-party
+||blorgkjhbhoqr.bid^$third-party
+||blprkaomvazv.com^$third-party
 ||blqgnbxva.com^$third-party
+||blrdumgvqkmq.com^$third-party
+||blvqxlczxeda.com^$third-party
 ||blwfqlmhi.com^$third-party
+||blwgtqakqaxemz.com^$third-party
+||blyppvdjofkqg.bid^$third-party
+||bmalhekpohve.bid^$third-party
+||bmayhacntxax.com^$third-party
+||bmbnpxxwxdt.com^$third-party
+||bmbvnmgucbk.com^$third-party
+||bmhvaoxr.com^$third-party
 ||bmichkohfqtnvq.com^$third-party
+||bmirhdkborr.bid^$third-party
+||bmjccqfxlabturkmpzzokhsahleqqrysudwpuzqjbxbqeakgnf.com^$third-party
+||bmjwsrcxvnsjne.com^$third-party
+||bmmqsdyud.com^$third-party
+||bmnccwprdrszpj.bid^$third-party
 ||bmoshyiypks.com^$third-party
+||bmqnguru.com^$third-party
+||bmsmhlpkdvajeo.bid^$third-party
+||bmubqabepbcb.com^$third-party
+||bmvhefgdlt.bid^$third-party
 ||bmwocmqtpi.com^$third-party
+||bmxufcsmxcfwao.bid^$third-party
 ||bmxyvebkmyy.com^$third-party
+||bmyepmehjzhz.com^$third-party
+||bnbotxyfewtroa.bid^$third-party
+||bndkifres.com^$third-party
+||bnfjallm.bid^$third-party
+||bniarapemvbd.com^$third-party
 ||bnjhbghjznq.com^$third-party
 ||bnjrtdsafo.com^$third-party
+||bnkgacehxxmx.com^$third-party
+||bnnsgqjofzar.com^$third-party
 ||bnpmudgktroz.com^$third-party
+||bnqaljyjkpwmiu.bid^$third-party
+||bnqgubwpq.com^$third-party
+||bnstnhto.com^$third-party
+||bnwjoqkudmh.bid^$third-party
 ||boaawvdg.com^$third-party
+||bocksnabswdq.com^$third-party
 ||bocqmlgslzoo.com^$third-party
+||boevznvrllm.bid^$third-party
+||bogkmogzrvzf.com^$third-party
+||boguaokxhdsa.com^$third-party
+||boiukzfgrp.bid^$third-party
 ||boizgpgrxvokd.com^$third-party
+||bolgooltxygp.com^$third-party
+||bomjrcum.bid^$third-party
 ||bonxsqstn.com^$third-party
 ||boqdapoiv.com^$third-party
 ||bowqoedgldc.com^$third-party
+||bowqvvztlkzn.com^$third-party
+||bpblqdfe.bid^$third-party
+||bpbwwasthwtp.com^$third-party
+||bpcegfmfzvkjmi.bid^$third-party
+||bpehfety.bid^$third-party
+||bpfxtrzapdxdr.bid^$third-party
+||bpglbuxwx.com^$third-party
+||bpilvlbzegwf.com^$third-party
 ||bplzgzpqp.com^$third-party
 ||bpmskwgodi.com^$third-party
 ||bpniszadiuc.com^$third-party
 ||bpnjigwalqjho.com^$third-party
+||bpprksdgogtw.com^$third-party
+||bprnphojtfl.bid^$third-party
 ||bpudfbrc.com^$third-party
+||bqbagfhhbhyzq.bid^$third-party
+||bqbkoyasur.com^$third-party
 ||bqchqjmbkt.com^$third-party
 ||bqcoenkrlqk.com^$third-party
+||bqdpscae.bid^$third-party
+||bqgvtryyrhjmf.com^$third-party
+||bqntkevvmkk.com^$third-party
+||bqptlqmtroto.com^$third-party
+||bqqjowpigdnx.com^$third-party
+||bqscwtvpvugopg.com^$third-party
 ||bqvgpuvjwhjggp.com^$third-party
+||bqyphmwr.bid^$third-party
+||bqytfutmwulr.com^$third-party
+||bqyzesmanfucq.com^$third-party
 ||brfyubakyg.com^$third-party
-||brloygpasa.com^$third-party
-||bryvvdtek.com^$third-party
-||bsjhbxtrbvkr.com^$third-party
-||bsmryjou.com^$third-party
-||bsrmcmvdoeyzib.com^$third-party
-||btgovcuviqor.com^$third-party
-||btovopyov.com^$third-party
-||bturlzbakbcsdd.com^$third-party
-||btzuecidcshmmv.com^$third-party
-||buadnqirhykcyc.com^$third-party
-||bugwiqivdqotjk.com^$third-party
-||bukpsslm.com^$third-party
-||burobtnbpgkh.com^$third-party
-||bvcddoyb.com^$third-party
-||bwohgwrk.com^$third-party
-||bwvigmkn.com^$third-party
-||bxejeqyudkgum.com^$third-party
-||bxknvtbmzsqc.com^$third-party
-||bxniyvvxufxyoy.com^$third-party
-||bxvydxjqklq.com^$third-party
-||bygigguvflpv.com^$third-party
-||bysziktift.com^$third-party
-||byxlivaqzo.com^$third-party
-||bzeitvxguf.com^$third-party
-||bzkmfzoxqmau.com^$third-party
-||bzotzfcbhomw.com^$third-party
-||bzrsybcg.com^$third-party
-||caajevalistl.com^$third-party
-||caaqyzbpsbtk.com^$third-party
-||camrfajedgku.com^$third-party
-||caucqpoeg.com^$third-party
-||cavdzowr.com^$third-party
-||cayqecxokz.com^$third-party
-||cbchvrgqb.com^$third-party
-||cbdjzemui.com^$third-party
-||cbhpiuopomc.com^$third-party
-||cbiapaofuviswf.com^$third-party
-||cbuxzegro.com^$third-party
-||cbzkrwjdskg.com^$third-party
-||ccemeoqbqb.com^$third-party
-||ccyttdkwntyhx.com^$third-party
-||cdaywwdyicf.com^$third-party
-||cdbhmahnjb.com^$third-party
-||cdegnloptetj.com^$third-party
-||cdmjjvqzurn.com^$third-party
-||cdookjqkri.com^$third-party
-||cdvoqspgdp.com^$third-party
-||cdyiipzo.com^$third-party
-||cdyygbzihdh.com^$third-party
-||cdzifdzftkmfof.com^$third-party
-||cekptlucf.com^$third-party
-||cfhkiriics.com^$third-party
-||cfnumapv.com^$third-party
-||cfpqhrfpccmpq.com^$third-party
-||cfqzixjwwqgow.com^$third-party
-||cfraazitu.com^$third-party
-||cfskcqrwbog.com^$third-party
-||cgaemihcbvr.com^$third-party
-||cgkpwhkgjxo.com^$third-party
-||cglpmszvpzzxj.com^$third-party
-||cglqqjxaaowb.com^$third-party
-||cgnfyfer.com^$third-party
-||cgociipdf.com^$third-party
-||cgrvnpkwuytts.com^$third-party
-||cgtqfbnviajcx.com^$third-party
-||cguvvvdxa.com^$third-party
-||chjfbjjgqts.com^$third-party
-||chjvykulvzey.com^$third-party
-||chnktglh.com^$third-party
-||chqspuonctkgz.com^$third-party
-||chvwtxtzmzbggo.com^$third-party
-||chxwlqtvgrw.com^$third-party
-||cifipkbu.com^$third-party
-||cifwsaufnalvh.com^$third-party
-||civyssfaqtufib.com^$third-party
-||cixvlpbnceh.com^$third-party
-||cizemeshbbc.com^$third-party
-||cjdomdjyvble.com^$third-party
-||cjgpifztileh.com^$third-party
-||cjojvvfyb.com^$third-party
-||cjsgmoekcb.com^$third-party
-||cjuztylaun.com^$third-party
-||cjwjpmudu.com^$third-party
-||ckopycdb.com^$third-party
-||ckxyvauhqfuoin.com^$third-party
-||clgyhwaoh.com^$third-party
-||clkkcokl.com^$third-party
-||clouxtnxsmxdva.com^$third-party
-||clsvugmivpf.com^$third-party
-||clsyxddpbt.com^$third-party
-||clutaqawmz.com^$third-party
-||clybtbahdbwkep.com^$third-party
-||cmnhwzdsvr.com^$third-party
-||cmrppltjs.com^$third-party
-||cnpntmju.com^$third-party
-||cofybuwuc.com^$third-party
-||coshfgpgab.com^$third-party
-||cqhxrlnhzlda.com^$third-party
-||cqjnxsbuplcqri.com^$third-party
-||cqwqxapujf.com^$third-party
-||cqyfjodshwuici.com^$third-party
-||cracwrddcb.com^$third-party
-||crcewevoy.com^$third-party
-||crgfbmzsk.com^$third-party
-||crheaeqw.com^$third-party
-||crjsrbyybipozq.com^$third-party
-||crrgnnqidpf.com^$third-party
-||crvvrxfgsvohiy.com^$third-party
-||crxhbchbd.com^$third-party
-||crykaxliilz.com^$third-party
-||csdzhoku.com^$third-party
-||cshzkkihjnweb.com^$third-party
-||csionjbak.com^$third-party
-||cskwckhyhriyk.com^$third-party
-||csouqeeviwo.com^$third-party
-||cspyozjbwb.com^$third-party
-||ctcpwymaeuwnqd.com^$third-party
-||ctjtlrmy.com^$third-party
-||ctrsopfwiadfjn.com^$third-party
-||ctsrwmcshv.com^$third-party
-||cttnlnsnwdokqb.com^$third-party
-||cujsutkdbz.com^$third-party
-||cukwbpne.com^$third-party
-||cvarxvlbnphcjq.com^$third-party
-||cvdvexais.com^$third-party
-||cvhcrbbbfaa.com^$third-party
-||cvjzauehxjsy.com^$third-party
-||cvzixxiesyjkha.com^$third-party
-||cwbbqhgtjbvtzi.com^$third-party
-||cwvdzcqvg.com^$third-party
-||cwvqtapvqbmxfd.com^$third-party
-||cxqmzfcfcwbwv.com^$third-party
-||cxunpvor.com^$third-party
-||cxxsegmhltakq.com^$third-party
-||cxzisvjhpt.com^$third-party
-||cybzsdkmrqgy.com^$third-party
-||cyfzthaduxhb.com^$third-party
-||cygngisr.com^$third-party
-||cyhcpeprgy.com^$third-party
-||cymeeoolym.com^$third-party
-||cytpfucbb.com^$third-party
-||czmolxvvrbb.com^$third-party
-||czqrilwnayq.com^$third-party
-||czsnzyykqzcreu.com^$third-party
-||czzzwuvvc.com^$third-party
-||dacknbenn.com^$third-party
-||daljntupdaoejb.com^$third-party
-||danunnpvy.com^$third-party
-||davthnojr.com^$third-party
-||dbcxaicjyt.com^$third-party
-||dbktgmyjph.com^$third-party
-||dbmysjylbpwrav.com^$third-party
-||dbuwkhpggim.com^$third-party
-||dccstsamnyrjk.com^$third-party
-||dckyimoylozbby.com^$third-party
-||dcqhbqwlcukxu.com^$third-party
-||dcxitlzzmyxbwn.com^$third-party
-||dcyeufoq.com^$third-party
-||ddbnikwub.com^$third-party
-||ddmlzfwsb.com^$third-party
-||degitlwfezpe.com^$third-party
-||deiqehvcdnntg.com^$third-party
-||dergevqzqi.com^$third-party
-||derqboxqca.com^$third-party
-||dewltdgzgtt.com^$third-party
-||dfawfyhesfe.com^$third-party
-||dfjaoecxqyox.com^$third-party
-||dfkpqvhcl.com^$third-party
-||dfmedtntwcepqx.com^$third-party
-||dfomexjuokpuxi.com^$third-party
-||dgkvriccq.com^$third-party
-||dglfkgmhahilp.com^$third-party
-||dgnuumyxpqiget.com^$third-party
-||dgowzelhoaqqb.com^$third-party
-||dgqktjmxtlp.com^$third-party
-||dgrvnlhz.com^$third-party
-||dhmwedckf.com^$third-party
-||dhtqupvxujyfp.com^$third-party
-||dieohupl.com^$third-party
-||dijutbdzbv.com^$third-party
-||dillweqbducwi.com^$third-party
-||dipsbbygv.com^$third-party
-||djagrjpaoek.com^$third-party
-||djiufagozzla.com^$third-party
-||djnroblmpyxrh.com^$third-party
-||dkgitkwo.com^$third-party
-||dktaqipmquo.com^$third-party
-||dkxeorhjmua.com^$third-party
-||dlotljikswmvq.com^$third-party
-||dlpypwmo.com^$third-party
-||dlwmksxohvw.com^$third-party
-||dlwssyqp.com^$third-party
-||dmgcxznqmmiek.com^$third-party
-||dmkadnohjoqh.com^$third-party
-||dmnangpsbpm.com^$third-party
-||dmrqnwtyttd.com^$third-party
-||dnftqfwycmfqrs.com^$third-party
-||dnpehliwdvjkp.com^$third-party
-||dnzevkqpk.com^$third-party
-||docqacvwhgbxv.com^$third-party
-||dojmlztmbrvp.com^$third-party
-||doksfyhdtqmipa.com^$third-party
-||donhyxngg.com^$third-party
-||dpnahzfbb.com^$third-party
-||dpoffxqjlgt.com^$third-party
-||dpwrhdzeqw.com^$third-party
-||dpwsvrkmfxrt.com^$third-party
-||dqdwvmpez.com^$third-party
-||dqekudhbwprx.com^$third-party
-||dqiokxyebdc.com^$third-party
-||dqmfeimedqswbr.com^$third-party
-||dqolgbehhzvo.com^$third-party
-||dqyczunj.com^$third-party
-||drjctivspweild.com^$third-party
-||droqnswhcfk.com^$third-party
-||drpmtzjanjqjpj.com^$third-party
-||drsemkuhpg.com^$third-party
-||drwfixovzqdcs.com^$third-party
-||dsemgngou.com^$third-party
-||dsgjefwejkc.com^$third-party
-||dsyxresmht.com^$third-party
-||dtgwjxeymdlri.com^$third-party
-||dthmzwzsgjibw.com^$third-party
-||dtjhwypfsayh.com^$third-party
-||dtqcjtkytuqn.com^$third-party
-||dtuhvgjyrp.com^$third-party
-||dtvlalitvg.com^$third-party
-||dugqbllwslqrlj.com^$third-party
-||durowueoaxjhd.com^$third-party
-||duwrigndkjp.com^$third-party
-||dvdyicsndqbqo.com^$third-party
-||dvhznawcuacblo.com^$third-party
-||dviavwhykcdp.com^$third-party
-||dvpgijdm.com^$third-party
-||dwhvkier.com^$third-party
-||dwopbruzifg.com^$third-party
-||dwuvmraztukg.com^$third-party
-||dwvfccxbj.com^$third-party
-||dxqorupwedbotu.com^$third-party
-||dxqxeklbsqe.com^$third-party
-||dxyafwkhrnycjp.com^$third-party
-||dxzgoyzo.com^$third-party
-||dxzkrtpnwpp.com^$third-party
-||dydxtkvmktumjp.com^$third-party
-||dyhwaacbbntu.com^$third-party
-||dylsjsmqjbbcs.com^$third-party
-||dymaffzxk.com^$third-party
-||dymzcxgdvf.com^$third-party
-||dypmzetaj.com^$third-party
-||dywqwrtnhegyz.com^$third-party
-||dzacosgvnz.com^$third-party
-||dzaqzgjsot.com^$third-party
-||dzblysulli.com^$third-party
-||dzkmbajm.com^$third-party
-||dzqoubtxsaskdl.com^$third-party
-||dzztjcbt.com^$third-party
-||eaffxhnzh.com^$third-party
-||eaffzvnyj.com^$third-party
-||ebbhjxspf.com^$third-party
-||ebfkifnjs.com^$third-party
-||ebgaxsjgdsnr.com^$third-party
-||ebicjwvxmygdqr.com^$third-party
-||ebifuaad.com^$third-party
-||ectysptouy.com^$third-party
-||edxosrcvydn.com^$third-party
-||edyjiqxeppjkj.com^$third-party
-||eeamatyc.com^$third-party
-||eefiywjjzxry.com^$third-party
-||eekmkywfke.com^$third-party
-||eencosteptffo.com^$third-party
-||eernnfbfby.com^$third-party
-||efebafmqn.com^$third-party
-||efekvyyynwd.com^$third-party
-||efzhzqtyomldfj.com^$third-party
-||egcocjwpzqsa.com^$third-party
-||eghuntsrizvbt.com^$third-party
-||ehhmynitx.com^$third-party
-||ehlfynuo.com^$third-party
-||ehraxliuwt.com^$third-party
-||ejgdixiddmruql.com^$third-party
-||ejlsbfqqxoc.com^$third-party
-||ejoyjumnsft.com^$third-party
-||ejwxbwzrhihtp.com^$third-party
-||ekbiwwngwig.com^$third-party
-||ekggptrw.com^$third-party
-||eklcrpehu.com^$third-party
-||ekmztfadigi.com^$third-party
-||eknfrwtxsde.com^$third-party
-||ekuuarqe.com^$third-party
-||ekxfupdlyst.com^$third-party
-||ekxlneryaiefwn.com^$third-party
-||elatsadlux.com^$third-party
-||elcolpplwua.com^$third-party
-||elfnwncr.com^$third-party
-||elimpfdlss.com^$third-party
-||eloumbsyd.com^$third-party
-||elvfmxguozafu.com^$third-party
-||elwbhndbxfqk.com^$third-party
-||emxztiidh.com^$third-party
-||emzxewhgjt.com^$third-party
-||enokjulejktukh.com^$third-party
-||entlydazhcmlgx.com^$third-party
-||enynwkvdb.com^$third-party
-||eofaplocyrcxhq.com^$third-party
-||eoruxpqn.com^$third-party
-||eotbkgjqu.com^$third-party
-||eozbwwxniksmb.com^$third-party
-||epbathcyav.com^$third-party
-||ephtwbxuqy.com^$third-party
-||eplocjhuxsoj.com^$third-party
-||epxokmckjkj.com^$third-party
-||eqdlypxvit.com^$third-party
-||eqezqqdpjmxbpb.com^$third-party
-||eqhawyidkdug.com^$third-party
-||eqrbfjwnmxpy.com^$third-party
-||erificyggw.com^$third-party
-||erireiejv.com^$third-party
-||ermjhgdl.com^$third-party
-||ervinguewty.com^$third-party
-||esfzbdwg.com^$third-party
-||esgnyfznnihl.com^$third-party
-||esundpxbixeqgu.com^$third-party
-||eszpmsipks.com^$third-party
-||etizspyjmjhxo.com^$third-party
-||etkdximarcsq.com^$third-party
-||etkhujhmhjix.com^$third-party
-||etmewatuh.com^$third-party
-||etuihxnhuxrofl.com^$third-party
-||eugxcnqw.com^$third-party
-||eutdrjvsrmav.com^$third-party
-||euuikdao.com^$third-party
-||euwyhbib.com^$third-party
-||evvpibrfqzjn.com^$third-party
-||ewgnexykqnyoun.com^$third-party
-||ewlnukukkca.com^$third-party
-||ewopxadcn.com^$third-party
-||ewrdeqrktgcu.com^$third-party
-||exbphrqpqukm.com^$third-party
-||exkruwviyy.com^$third-party
-||eyqletzkhybsef.com^$third-party
-||eytqtjpjnmeas.com^$third-party
-||ezgswchaz.com^$third-party
-||ezhinpwh.com^$third-party
-||ezjepifcz.com^$third-party
-||ezlxnyhbjtqr.com^$third-party
-||ezqldmevi.com^$third-party
-||ezrutveckpuly.com^$third-party
-||ezuereisgj.com^$third-party
-||fabrtgzehf.com^$third-party
-||faegbmhey.com^$third-party
-||fbhfbgtj.com^$third-party
-||fbpetrwt.com^$third-party
-||fcbykurluasdeu.com^$third-party
-||fcihwhsiukz.com^$third-party
-||fcjodgfpjiswa.com^$third-party
-||fcpispplqq.com^$third-party
-||fdbrwxtm.com^$third-party
-||fdrkesvb.com^$third-party
-||fdrqokusnwpq.com^$third-party
-||fdxdjkswppg.com^$third-party
-||fdzylxffu.com^$third-party
-||febalwby.com^$third-party
-||fehsnwiem.com^$third-party
-||fejbkpidkkwts.com^$third-party
-||fepzygektdt.com^$third-party
-||fevgukzwvjam.com^$third-party
-||fevrbniqa.com^$third-party
-||ffaspwzfq.com^$third-party
-||ffcqkvdaklrqkg.com^$third-party
-||ffjzebtmdwi.com^$third-party
-||ffpnlrnmfyeqx.com^$third-party
-||fgnzizhe.com^$third-party
-||fgsjjpjhdlfthp.com^$third-party
-||fgsmmpazsuqak.com^$third-party
-||fgtdzvlydqcpus.com^$third-party
-||fgzxlngohtg.com^$third-party
-||fhluqrhmqs.com^$third-party
-||fhsohqtif.com^$third-party
-||fhtlyoqzyjjof.com^$third-party
-||fifnonxntvaszg.com^$third-party
-||fjeqkpblfb.com^$third-party
-||fjocjdbo.com^$third-party
-||fjszsffyfihqlg.com^$third-party
-||fjwagiuqmeymw.com^$third-party
-||fjxssyatdwttqm.com^$third-party
-||fkfmujcudpwdn.com^$third-party
-||fkrgfktdvta.com^$third-party
-||fkvjntfj.com^$third-party
-||flbecoidmt.com^$third-party
-||flepzrkdwm.com^$third-party
-||flgstgrcwapk.com^$third-party
-||flnqkhnqjcmvp.com^$third-party
-||flvuylhsyg.com^$third-party
-||fmcktrmnlyfjr.com^$third-party
-||fmxnlkoaf.com^$third-party
-||fngoubeq.com^$third-party
-||fnmubgld.com^$third-party
-||fnuuhrhfkvpbnm.com^$third-party
-||fofjazpwccc.com^$third-party
-||fosclhrsdhhn.com^$third-party
-||fpcptdqmjlnlu.com^$third-party
-||fpdsavexteno.com^$third-party
-||fpfivothg.com^$third-party
-||fpluhtibx.com^$third-party
-||fpoxpjpxn.com^$third-party
-||fpqeowmsv.com^$third-party
-||fpsnezwiumsv.com^$third-party
-||fpunplooxphq.com^$third-party
-||fpxkjlzmkqp.com^$third-party
-||fpxthotxzuf.com^$third-party
-||fpzcaabzhvzz.com^$third-party
-||fpzcyccpqldc.com^$third-party
-||fqbrdnpf.com^$third-party
-||fqckdxjgle.com^$third-party
-||fqhpssdbenl.com^$third-party
-||fqldrulyjfnt.com^$third-party
-||fqqtlkuklrd.com^$third-party
-||fqufpknrarn.com^$third-party
-||frbhjvazapgo.com^$third-party
-||frcinpdv.com^$third-party
-||frfgfhzxtfvsp.com^$third-party
-||frqmnrlqk.com^$third-party
-||frtfwlvwuw.com^$third-party
-||frxohovv.com^$third-party
-||fscslwmvbadncb.com^$third-party
-||fsdvydpldxrbu.com^$third-party
-||fsiadjbirgobi.com^$third-party
-||fsindvlkmrqnie.com^$third-party
-||fsjvhkobubai.com^$third-party
-||fsmpxxdyv.com^$third-party
-||fsnhesxsw.com^$third-party
-||fsohxklbxdi.com^$third-party
-||fsqknqvlngde.com^$third-party
-||ftqgkcmbkptohh.com^$third-party
-||ftttziizhuplfj.com^$third-party
-||ftuohzeijbkm.com^$third-party
-||ftvwoljibdwd.com^$third-party
-||ftxekufylzqis.com^$third-party
-||ftymzxmic.com^$third-party
-||fuaawvoqbzza.com^$third-party
-||fuialqqq.com^$third-party
-||fukkzdxfyrchhc.com^$third-party
-||fupgvldb.com^$third-party
-||fuwgbbkktwbu.com^$third-party
-||fuymatqqiyz.com^$third-party
-||fvenxjtzuaxu.com^$third-party
-||fveugxikrgrbsh.com^$third-party
-||fviwwkvvxs.com^$third-party
-||fvsdvxjpxi.com^$third-party
-||fvtwyjev.com^$third-party
-||fvzompquocgdsu.com^$third-party
-||fvzusqdf.com^$third-party
-||fwbhvrpiunlzyh.com^$third-party
-||fwwdmnkjg.com^$third-party
-||fwyofqdypydo.com^$third-party
-||fwzqogrlgsdl.com^$third-party
-||fxazopwrns.com^$third-party
-||fxdglnldbnyq.com^$third-party
-||fxfxpyrq.com^$third-party
-||fxlmstfrxtqp.com^$third-party
-||fxpqoyxlas.com^$third-party
-||fxvbsnwnwoib.com^$third-party
-||fynprrom.com^$third-party
-||fyphnmoz.com^$third-party
-||fytrvzettfn.com^$third-party
-||fyyyyppk.com^$third-party
-||fzbnuyjgyexs.com^$third-party
-||fzbyrntsjxhcmb.com^$third-party
-||fzccvcrsbtb.com^$third-party
-||fzcyyqvrbrpk.com^$third-party
-||fzrqfakeaqikwm.com^$third-party
-||fzwxuqoy.com^$third-party
-||gaqhseuqp.com^$third-party
-||gbwhqbiiq.com^$third-party
-||gbybvvfo.com^$third-party
-||gbytjlggor.com^$third-party
-||gcpbftsiwdrajj.com^$third-party
-||gdbmpwlhf.com^$third-party
-||gdczbvckwjafu.com^$third-party
-||gdtbpaqa.com^$third-party
-||gdwwpvwq.com^$third-party
-||gdyelbwku.com^$third-party
-||gdyjhclaxvqz.com^$third-party
-||gecxceztcnhkmh.com^$third-party
-||gekywqwky.com^$third-party
-||gfamqlcmymxbeu.com^$third-party
-||gfchcxin.com^$third-party
-||gfuhjlpnuj.com^$third-party
-||gfyrxikptop.com^$third-party
-||ggezvffghs.com^$third-party
-||ggijrjktcld.com^$third-party
-||ggprfmbbl.com^$third-party
-||gguvdsglzjyca.com^$third-party
-||ggxvxrmrjitg.com^$third-party
-||ghjlhnbc.com^$third-party
-||ghkajgexob.com^$third-party
-||ghkhvajwsiy.com^$third-party
-||ghomifuzhobtoo.com^$third-party
-||ghytjserb.com^$third-party
-||gifjvmfkzykp.com^$third-party
-||girrjaqgjb.com^$third-party
-||gisiwdcqte.com^$third-party
-||gjijrevdp.com^$third-party
-||gjliurjvfnkymq.com^$third-party
-||gjmlseezqjy.com^$third-party
-||gjnusfiby.com^$third-party
-||gjriyqsfrnvuv.com^$third-party
-||gjyfmlrqssyj.com^$third-party
-||gkaatcjxwa.com^$third-party
-||gkatquevzk.com^$third-party
-||gkhfahrtren.com^$third-party
-||glbsuoebquueky.com^$third-party
-||glfiivzom.com^$third-party
-||gltpstgjnyb.com^$third-party
-||glvjbogft.com^$third-party
-||glvzlhrrdjlme.com^$third-party
-||glzaaewyvdkae.com^$third-party
-||gmcyfkrtw.com^$third-party
-||gmeomlvmqlmu.com^$third-party
-||gmowaloqmhtd.com^$third-party
-||gmqczpcyzjeen.com^$third-party
-||gmquualzdmqtxp.com^$third-party
-||gmutfgxdvwmtf.com^$third-party
-||gmwqmjkggg.com^$third-party
-||gmxetthnzmqo.com^$third-party
-||gnkpuprxa.com^$third-party
-||gnreqzzts.com^$third-party
-||goiqwteaxvgc.com^$third-party
-||golkkzpniri.com^$third-party
-||gonuuudpdcu.com^$third-party
-||gouowkjmewn.com^$third-party
-||gpatesbcesl.com^$third-party
-||gpdqzmhayrcgsy.com^$third-party
-||gpudqmly.com^$third-party
-||gpuulhuupfinoq.com^$third-party
-||gpzywrsrcr.com^$third-party
-||gqekfxgdaxoau.com^$third-party
-||gqlaoeyczxsvk.com^$third-party
-||gqlmavnoavcaw.com^$third-party
-||gqosdcpjxajae.com^$third-party
-||gqqsqbipuhlzb.com^$third-party
-||gqrsxfwxvx.com^$third-party
-||gqrwjsjbnoayff.com^$third-party
-||gqrxsjqo.com^$third-party
-||grgxptjsgl.com^$third-party
-||grkrkurbyykok.com^$third-party
-||grlygpybnhbwcu.com^$third-party
-||grsdvgnr.com^$third-party
-||grsnseuoispsco.com^$third-party
-||gsghbxydcyum.com^$third-party
-||gsjhehtqvin.com^$third-party
-||gtbrnqncz.com^$third-party
-||gtkikiwa.com^$third-party
-||gtlcgovlg.com^$third-party
-||gtnmyddlf.com^$third-party
-||gtorsoxdh.com^$third-party
-||gudlhvxz.com^$third-party
-||gugemfslzh.com^$third-party
-||guhpyglt.com^$third-party
-||gumdeqjzclc.com^$third-party
-||guoyhfjrpt.com^$third-party
-||gutccaxnwso.com^$third-party
-||gvahzhgblkkyr.com^$third-party
-||gvhqnlti.com^$third-party
-||gvoraoonpi.com^$third-party
-||gvwyxnyq.com^$third-party
-||gwovohvkzay.com^$third-party
-||gwxaulcgmizcq.com^$third-party
-||gxeoadmo.com^$third-party
-||gxklbrtpqqyvy.com^$third-party
-||gxleeixyzlaaab.com^$third-party
-||gxpijskyqwqfjw.com^$third-party
-||gxptetvbtkfj.com^$third-party
-||gxqocoxl.com^$third-party
-||gxxkrzrvy.com^$third-party
-||gxzfpusmd.com^$third-party
-||gynzvwhup.com^$third-party
-||gyycgkchjtimu.com^$third-party
-||gzmknnasowdtop.com^$third-party
-||gzoprhvqhie.com^$third-party
-||gzqoxmkuhl.com^$third-party
-||hafksvqiir.com^$third-party
-||hagiqxizxqf.com^$third-party
-||hamjgkzgycmur.com^$third-party
-||hanimyel.com^$third-party
-||haqbllmvpbqc.com^$third-party
-||hasrijwnxtn.com^$third-party
-||hauvkkwrbme.com^$third-party
-||hayxktgbqpmult.com^$third-party
-||hbbgrhzqezz.com^$third-party
-||hbhcilgdqxt.com^$third-party
-||hbkajyvrus.com^$third-party
-||hbycvbyyj.com^$third-party
-||hcijbbzz.com^$third-party
-||hcmafnawzxfnam.com^$third-party
-||hcmjlsxhebb.com^$third-party
-||hcqjgkpg.com^$third-party
-||hcycanmscyg.com^$third-party
-||hcyqwhquqjosn.com^$third-party
-||hdcfyrzx.com^$third-party
-||hddzzizitskc.com^$third-party
-||hdfsruiqwgjdo.com^$third-party
-||hdnvtfyvyhq.com^$third-party
-||hdoabbjyyebca.com^$third-party
-||hduefoyd.com^$third-party
-||hdwjwooqvnm.com^$third-party
-||hdwkcfqzxhvx.com^$third-party
-||hdxfyoziizy.com^$third-party
-||heaaizwhm.com^$third-party
-||hefgfqcyfmv.com^$third-party
-||hehraybryciyls.com^$third-party
-||hezasoiduicbha.com^$third-party
-||hfedqcww.com^$third-party
-||hffgptqfpewjz.com^$third-party
-||hfslmsbj.com^$third-party
-||hfubvezyoyqs.com^$third-party
-||hgbxmqyqoplpif.com^$third-party
-||hgdmzshm.com^$third-party
-||hgowmgat.com^$third-party
-||hheeffxjz.com^$third-party
-||hhffiibyamkvyu.com^$third-party
-||hhleomgyiruth.com^$third-party
-||hhlrnfmn.com^$third-party
-||hhrxmgaepe.com^$third-party
-||higishzxn.com^$third-party
-||hiitwzyvkdyvxn.com^$third-party
-||hjbfpopj.com^$third-party
-||hjgmasrve.com^$third-party
-||hjihwmtsltqi.com^$third-party
-||hjjdmohuzp.com^$third-party
-||hjjjsurdhtt.com^$third-party
-||hjknszojbbecy.com^$third-party
-||hjnekvux.com^$third-party
-||hjxrhlmei.com^$third-party
-||hjyhfusvr.com^$third-party
-||hkhotpewfxr.com^$third-party
-||hkjxihngzlmwc.com^$third-party
-||hkoxznukwpdhxu.com^$third-party
-||hkwzswzf.com^$third-party
-||hldsogaxfq.com^$third-party
-||hloyloppqpvnmd.com^$third-party
-||hlvvlouaeicp.com^$third-party
-||hlvzvisiwbtuwv.com^$third-party
-||hmepgymo.com^$third-party
-||hmgozryqbc.com^$third-party
-||hmzwcomigpqia.com^$third-party
-||hnhsvlswqtoxgn.com^$third-party
-||hnntopkvrsivwc.com^$third-party
-||hnregzjxsafu.com^$third-party
-||hnshjxowpldar.com^$third-party
-||hntntnfizowo.com^$third-party
-||hntxitqhto.com^$third-party
-||hoghqjddg.com^$third-party
-||hogylomirfc.com^$third-party
-||hohrnldconk.com^$third-party
-||hoqqzlvwukpo.com^$third-party
-||hoyqhygv.com^$third-party
-||hpbczauldndnep.com^$third-party
-||hpbsyqsypxy.com^$third-party
-||hpkkzzyek.com^$third-party
-||hpsthxyqxqae.com^$third-party
-||hpufwccrmiwz.com^$third-party
-||hpwsosviqyjem.com^$third-party
-||hpxbifcd.com^$third-party
-||hqbphxpavrxry.com^$third-party
-||hqgenotbptcu.com^$third-party
-||hqkwnyub.com^$third-party
-||hqqyesittgihp.com^$third-party
-||hqsgnzvjkyog.com^$third-party
-||hqtlbsglscrju.com^$third-party
-||hqtvvfqmfykcrs.com^$third-party
-||hqupjfmq.com^$third-party
-||hqwlpexoywbc.com^$third-party
-||hqyenmzgxk.com^$third-party
-||hraowdzgs.com^$third-party
-||hrarjpeqtcsge.com^$third-party
-||hrcqeghr.com^$third-party
-||hrorxufknjdm.com^$third-party
-||hrtxufdb.com^$third-party
-||hsgatgymg.com^$third-party
-||hsqslxewsnga.com^$third-party
-||hsqvofrzwluvns.com^$third-party
-||hstqqjxqwnrfhy.com^$third-party
-||hsufwxpdtddlh.com^$third-party
-||hsydzoapohcvbz.com^$third-party
-||htegogwj.com^$third-party
-||htlvvqlcqvq.com^$third-party
-||htmvtmglofpbz.com^$third-party
-||hugjupzdpvuzdr.com^$third-party
-||huhrxmgiofzna.com^$third-party
-||hvgytlbdnuqunp.com^$third-party
-||hvitcycze.com^$third-party
-||hvpcxythnjl.com^$third-party
-||hwhdxuid.com^$third-party
-||hwhzonbib.com^$third-party
-||hwiccseamrs.com^$third-party
-||hxhxjcffzp.com^$third-party
-||hxhyejtblmu.com^$third-party
-||hxqetblh.com^$third-party
-||hxvuuswzydwykb.com^$third-party
-||hyrnujewyatvd.com^$third-party
-||hysnqwbokyuvsm.com^$third-party
-||hysyqgbls.com^$third-party
-||hyurzuxoksg.com^$third-party
-||hztjenzlrrwinq.com^$third-party
-||hzwmcqlmxpdrlp.com^$third-party
-||iaatzkkqyv.com^$third-party
-||iacexhglty.com^$third-party
-||iafqqcsw.com^$third-party
-||iapxxrjzc.com^$third-party
-||iasodjsbjcq.com^$third-party
-||iatwyqgvpq.com^$third-party
-||ibclxtlh.com^$third-party
-||ibetinwubwl.com^$third-party
-||ibfsream.com^$third-party
-||ibfueyttemsefi.com^$third-party
-||ibnuoduab.com^$third-party
-||icahllwjc.com^$third-party
-||icfjzmqsejzfb.com^$third-party
-||icfxndxwpan.com^$third-party
-||icjpdubxgab.com^$third-party
-||ictmdbus.com^$third-party
-||icuazeczpeoohx.com^$third-party
-||idbjhskxiablsi.com^$third-party
-||idbtfwllhogxc.com^$third-party
-||iddvmkxme.com^$third-party
-||ideprjebdvj.com^$third-party
-||idernzastoeok.com^$third-party
-||idissynmirkw.com^$third-party
-||idqzpnea.com^$third-party
-||idrdmyixk.com^$third-party
-||idszrbmjvkdodt.com^$third-party
-||idxrjpfxrqernb.com^$third-party
-||iedijlgkbqc.com^$third-party
-||ieqbsnteuyn.com^$third-party
-||ifbhceoxx.com^$third-party
-||ifdmdfqysaacqa.com^$third-party
-||ifecuwzjajkiq.com^$third-party
-||iffzxqnhd.com^$third-party
-||ifgnsrtjcz.com^$third-party
-||iflndvke.com^$third-party
-||ifoldmuxqjeddk.com^$third-party
-||igbznxar.com^$third-party
-||iggukjfuylwyv.com^$third-party
-||igsxvpghnamnsz.com^$third-party
-||ihcbfiqkp.com^$third-party
-||ihvmcqojoj.com^$third-party
-||iiccrpwaxmxkqm.com^$third-party
-||iilrgkor.com^$third-party
-||iizgpusp.com^$third-party
-||ijfnbtksuntwqe.com^$third-party
-||ijhqzvlnsxu.com^$third-party
-||ijmzezsaxxomr.com^$third-party
-||ijnghdmfrb.com^$third-party
-||ijowsfraldsnb.com^$third-party
-||ijriehir.com^$third-party
-||ikhdsnufzzj.com^$third-party
-||ikupicwg.com^$third-party
-||ikvagxovc.com^$third-party
-||ilaantxayy.com^$third-party
-||ilclngnarpy.com^$third-party
-||ilkphyyzg.com^$third-party
-||illazkka.com^$third-party
-||ilqufadqxd.com^$third-party
-||ilugfyhlfv.com^$third-party
-||iluwjbuwm.com^$third-party
-||ilxwlsnzhzukj.com^$third-party
-||imayjubge.com^$third-party
-||imbpmlyhkk.com^$third-party
-||imevdywafhro.com^$third-party
-||imidshmpzr.com^$third-party
-||immscjnenl.com^$third-party
-||imnsmvmjrdiwwr.com^$third-party
-||inhcrirmboz.com^$third-party
-||iogutpkrkkycq.com^$third-party
-||ioiylgyf.com^$third-party
-||ioujbpldicfgm.com^$third-party
-||iozpujvmlojzhp.com^$third-party
-||ipacpdxmvwyi.com^$third-party
-||ipehunxxyir.com^$third-party
-||ipesdpqmq.com^$third-party
-||ipluhckk.com^$third-party
-||ipncblpgxlhjpc.com^$third-party
-||ippwkczttno.com^$third-party
-||ipwwqitqsh.com^$third-party
-||ipxdoldjsvnjvw.com^$third-party
-||iqagrsach.com^$third-party
-||iqbfctebbzh.com^$third-party
-||iqopeoufjul.com^$third-party
-||iqyirwfzlx.com^$third-party
-||irfiysdcrnleu.com^$third-party
-||isfxsiooyjad.com^$third-party
-||isnsgjhthhaqtu.com^$third-party
-||ispaagigjygd.com^$third-party
-||isxwajatbig.com^$third-party
-||itlmnxlauah.com^$third-party
-||itsyuvrlesq.com^$third-party
-||itxljhric.com^$third-party
-||itzgybxfrbodq.com^$third-party
-||iuawzhuqjl.com^$third-party
-||iuhojiqev.com^$third-party
-||iuhpbpzwpldqbj.com^$third-party
-||iuncajvw.com^$third-party
-||iuooczzbi.com^$third-party
-||ivowhzku.com^$third-party
-||ivvoooxuyjfuo.com^$third-party
-||iwapwcqg.com^$third-party
-||iwfzluau.com^$third-party
-||iwgdguuz.com^$third-party
-||ixskusmnsb.com^$third-party
-||ixsogpaexhgzn.com^$third-party
-||ixtmbdajhvimtv.com^$third-party
-||ixvzraajuiniwg.com^$third-party
-||ixwbgjnjf.com^$third-party
-||iybkbyciv.com^$third-party
-||iydppfwjgcjs.com^$third-party
-||iyfrmewyned.com^$third-party
-||iykrtmswkibdp.com^$third-party
-||iylndfmf.com^$third-party
-||iyqchvtlklbxm.com^$third-party
-||izavihllfvej.com^$third-party
-||izedcwsouaszk.com^$third-party
-||izwzyhlm.com^$third-party
-||jacmnkcusf.com^$third-party
-||jaihowgr.com^$third-party
-||jajkgegza.com^$third-party
-||jakzpcgrxgda.com^$third-party
-||jbcadlpdfsxsfe.com^$third-party
-||jbdddxgjn.com^$third-party
-||jbwunmehf.com^$third-party
-||jccszmkabdean.com^$third-party
-||jcjrcmaunbqxg.com^$third-party
-||jcllysqtvlro.com^$third-party
-||jcmdvfrn.com^$third-party
-||jcrqhscfqqbgby.com^$third-party
-||jcsisvtb.com^$third-party
-||jdbovkzjtuup.com^$third-party
-||jdrckkbpb.com^$third-party
-||jdskyjntuhea.com^$third-party
-||jducqfnxeypyw.com^$third-party
-||jecbbkrnfn.com^$third-party
-||jeeumttalzwt.com^$third-party
-||jegugqcvo.com^$third-party
-||jenaowzhtbi.com^$third-party
-||jevxjcdnrd.com^$third-party
-||jffdktcyr.com^$third-party
-||jfjuhxfllw.com^$third-party
-||jfnafbcysy.com^$third-party
-||jfvadxjr.com^$third-party
-||jgerrmaktdzyh.com^$third-party
-||jgjpicgy.com^$third-party
-||jgrsqcqdfwzu.com^$third-party
-||jguczdjzvfp.com^$third-party
-||jhceybuguvureg.com^$third-party
-||jheduynirrxkro.com^$third-party
-||jhijojlatyvri.com^$third-party
-||jhmmbrfsqm.com^$third-party
-||jhwkypuhrw.com^$third-party
-||jhxpbihkucrq.com^$third-party
-||jhybwydghelnd.com^$third-party
-||jiiyddosyv.com^$third-party
-||jimqcqsyhser.com^$third-party
-||jimxaqrpqbxldt.com^$third-party
-||jirmbsgr.com^$third-party
-||jiyvkdfab.com^$third-party
-||jjhnnzef.com^$third-party
-||jjokvprdxwf.com^$third-party
-||jjptjphnkrqnc.com^$third-party
-||jkamuwyswgk.com^$third-party
-||jkawfxvh.com^$third-party
-||jkciacmcnya.com^$third-party
-||jkcvevwvgfopog.com^$third-party
-||jkjcoyeeglunz.com^$third-party
-||jkvkhgztow.com^$third-party
-||jkywbooyc.com^$third-party
-||jlkqurysdsw.com^$third-party
-||jlmnnrwuqz.com^$third-party
-||jlsydeysmgghdy.com^$third-party
-||jlvqbfknjajot.com^$third-party
-||jlwejibe.com^$third-party
-||jndnkgjqlxr.com^$third-party
-||jngxxwythaf.com^$third-party
-||jnhjvkapqf.com^$third-party
-||jnhmeywrl.com^$third-party
-||jnjbdvchvk.com^$third-party
-||jnljkbkiaqcmb.com^$third-party
-||jnnswtdifjgx.com^$third-party
-||johonmtpyv.com^$third-party
-||josxzdszqaivb.com^$third-party
-||jotpybmcjvg.com^$third-party
-||jozfwcmrxkwva.com^$third-party
-||jpabviwck.com^$third-party
-||jpdauipgz.com^$third-party
-||jpmpvhelfeg.com^$third-party
-||jpmyudcnpgl.com^$third-party
-||jpqmviofsf.com^$third-party
-||jpvmwnnwuzo.com^$third-party
-||jpxevzab.com^$third-party
-||jqanygfhqne.com^$third-party
-||jqgblwjfvox.com^$third-party
-||jqpuxvgnxkf.com^$third-party
-||jqqlucchmbxnn.com^$third-party
-||jqrnfkttwfxbcu.com^$third-party
-||jqsrfzjgn.com^$third-party
-||jractwjn.com^$third-party
-||jrarnqfvjijaa.com^$third-party
-||jrrekpskc.com^$third-party
-||jtmwjkkoes.com^$third-party
-||jtveisrh.com^$third-party
-||juqakqgv.com^$third-party
-||juuwyyvjecnvps.com^$third-party
-||juvqtttkhz.com^$third-party
-||jvjwaxjixypm.com^$third-party
-||jvkhhxwcnijvmf.com^$third-party
-||jvqbbfrg.com^$third-party
-||jwbroglwc.com^$third-party
-||jwgsepzz.com^$third-party
-||jwwyuxjv.com^$third-party
-||jxexqemgbxvv.com^$third-party
-||jxmhgmkuw.com^$third-party
-||jxnwpeqkhtkrw.com^$third-party
-||jxseoruuv.com^$third-party
-||jxusrymeeqyi.com^$third-party
-||jyahmckzsbh.com^$third-party
-||jyccdcavzpqt.com^$third-party
-||jyujouii.com^$third-party
-||jyymhnyr.com^$third-party
-||jzbutifk.com^$third-party
-||jzfzgkepkjcf.com^$third-party
-||jzgtnetghdc.com^$third-party
-||jzjhcpdf.com^$third-party
-||jzkznpleaqshdj.com^$third-party
-||jzllgntkazui.com^$third-party
-||jzqvmpkppjlgc.com^$third-party
-||kacfofrcndc.com^$third-party
-||kaktokualscgea.com^$third-party
-||kakywxgevuv.com^$third-party
-||kalfiydydtnhxk.com^$third-party
-||kaojrivmhys.com^$third-party
-||katxkxcncwool.com^$third-party
-||kbdstwnruc.com^$third-party
-||kbgyxsoskilli.com^$third-party
-||kbkvptlxijafb.com^$third-party
-||kbqebfcubeiaa.com^$third-party
-||kbwortdqjbns.com^$third-party
-||kcarnzeaipjssg.com^$third-party
-||kcetcukaolxc.com^$third-party
-||kcitwbcc.com^$third-party
-||kcnyhfmowc.com^$third-party
-||kcodndvh.com^$third-party
-||kcugdqmmfcqrb.com^$third-party
-||kdfjjvidllnbaa.com^$third-party
-||kdpqydaxbxztnh.com^$third-party
-||kdyfsgpa.com^$third-party
-||kfxrukfzqazrs.com^$third-party
-||kfyhxmycgjaqkn.com^$third-party
-||kfyksytsx.com^$third-party
-||kfypsloqkccvpl.com^$third-party
-||kgdglkxy.com^$third-party
-||kgkkfrvujnqf.com^$third-party
-||kgobpqziy.com^$third-party
-||kgqlrcjlrx.com^$third-party
-||kgxemdznctlmya.com^$third-party
-||khaicoojypokng.com^$third-party
-||khdmabhykmj.com^$third-party
-||khefhmgfwnnqgv.com^$third-party
-||kieecarfftwf.com^$third-party
-||kiejztfpkfayak.com^$third-party
-||kifxgosycvxplk.com^$third-party
-||kiobmbncsrwc.com^$third-party
-||kiqsynap.com^$third-party
-||kjizuuuvqbcd.com^$third-party
-||kjsedplonmifbe.com^$third-party
-||kjtcdiyzd.com^$third-party
-||kksoyysmpp.com^$third-party
-||klhjuuwrmxyjsn.com^$third-party
-||klhvqeajy.com^$third-party
-||klnzalfz.com^$third-party
-||klxteeltivy.com^$third-party
-||klzvkrzluqnx.com^$third-party
-||kmalnsqvyygwe.com^$third-party
-||kmjexpirqstyzv.com^$third-party
-||kmkdkefa.com^$third-party
-||kmpcmafvqf.com^$third-party
-||kmypiwpbastt.com^$third-party
-||knepsiwviviwed.com^$third-party
-||knimmqli.com^$third-party
-||knndhcnwv.com^$third-party
-||knnvmkbemftwgj.com^$third-party
-||knpbefvk.com^$third-party
-||knqjhdkndh.com^$third-party
-||knwfmpvtj.com^$third-party
-||koamxmikmuhahc.com^$third-party
-||kozloiczght.com^$third-party
-||kpchywhqcrkz.com^$third-party
-||kpgjogkbwjpmz.com^$third-party
-||kpoplhjnhlagy.com^$third-party
-||kpwjtpgvowifq.com^$third-party
-||kqflgvrwqpzwue.com^$third-party
-||kqohskoysgxx.com^$third-party
-||krpdqnnb.com^$third-party
-||krtdobasy.com^$third-party
-||krtpkaha.com^$third-party
-||ksihafqopndbq.com^$third-party
-||ksrcnyrntlyfo.com^$third-party
-||ksufusxqd.com^$third-party
-||ktdthraxzxt.com^$third-party
-||ktfjyexcacujjg.com^$third-party
-||ktjcrhdppesdd.com^$third-party
-||ktzwdewsckssid.com^$third-party
-||kujwlsnl.com^$third-party
-||kumjidmumktzq.com^$third-party
-||kumtwckyq.com^$third-party
-||kuvlikgekekwp.com^$third-party
-||kvdguzclhatdul.com^$third-party
-||kvdjcnerhxzb.com^$third-party
-||kvhxckkd.com^$third-party
-||kvnldhrlw.com^$third-party
-||kwajysvvjeyvs.com^$third-party
-||kwcrryneebg.com^$third-party
-||kweayxzfazrws.com^$third-party
-||kwflzktzaxczm.com^$third-party
-||kwkxvbjz.com^$third-party
-||kwomkjjoajcyyt.com^$third-party
-||kwsmqtposrub.com^$third-party
-||kwygntce.com^$third-party
-||kxemsltfmm.com^$third-party
-||kxkeuums.com^$third-party
-||kxzmmtdx.com^$third-party
-||kycsebgx.com^$third-party
-||kyelvsyayysa.com^$third-party
-||kygozmlrr.com^$third-party
-||kzlmwsyftm.com^$third-party
-||labdwkqyavb.com^$third-party
-||lajpmujdntg.com^$third-party
-||lamwiadakwa.com^$third-party
-||lanktydm.com^$third-party
-||lawvcpqtapzsh.com^$third-party
-||lbaybxwiklnfe.com^$third-party
-||lbkprcoosfgk.com^$third-party
-||lburmovcjefv.com^$third-party
-||lcmkcvisyynkw.com^$third-party
-||lcolevwciuwj.com^$third-party
-||lcsgdwlxrlgq.com^$third-party
-||lcttjawsbwol.com^$third-party
-||lcvofuqxovcao.com^$third-party
-||lcxrimmb.com^$third-party
-||ldgananrrtx.com^$third-party
-||ldvmpopwd.com^$third-party
-||ledvqaldtf.com^$third-party
-||lesmyjzc.com^$third-party
-||lfjmmgorkjoaw.com^$third-party
-||lfjvaaswkxqj.com^$third-party
-||lfqocbhv.com^$third-party
-||lfrqmuplp.com^$third-party
-||lghrdwdl.com^$third-party
-||lgjboylszpij.com^$third-party
-||lgjqgatg.com^$third-party
-||lhdndgmsy.com^$third-party
-||lhjisbsegvxf.com^$third-party
-||lhtekmhy.com^$third-party
-||lhuetsviudr.com^$third-party
-||lhytmylpwfzuzm.com^$third-party
-||liadlzantv.com^$third-party
-||liesiotlpfvjm.com^$third-party
-||liuduuct.com^$third-party
-||liulwxrybupyzu.com^$third-party
-||ljjaiargqfwtzu.com^$third-party
-||ljkihuolgoh.com^$third-party
-||ljkmwpvahv.com^$third-party
-||ljrljohnoqa.com^$third-party
-||lkhkeviyctneka.com^$third-party
-||lkksbzcslmeefw.com^$third-party
-||lkmoqyzfv.com^$third-party
-||lknxarjfidm.com^$third-party
-||lkohqfilvpked.com^$third-party
-||lkojwhiwcsum.com^$third-party
-||lkuirehx.com^$third-party
-||lkzvhtetshbu.com^$third-party
-||llgvjtkg.com^$third-party
-||llhjbwcjnuii.com^$third-party
-||lliumrpvj.com^$third-party
-||llpdtbmowsg.com^$third-party
-||llrblpesvjc.com^$third-party
-||llsdercqm.com^$third-party
-||llvidwpt.com^$third-party
-||lmccawemcuqma.com^$third-party
-||lmcoiiwpguaorp.com^$third-party
-||lmepqfsazb.com^$third-party
-||lmevacaixeqy.com^$third-party
-||lmjxrhph.com^$third-party
-||lmlvzeeag.com^$third-party
-||lmsycyfh.com^$third-party
-||lnicyniqxdxg.com^$third-party
-||lnpqqigowz.com^$third-party
-||lnwbiuetoymifj.com^$third-party
-||logkzudhrg.com^$third-party
-||lohxvwjpvl.com^$third-party
-||lojuxbnt.com^$third-party
-||loteumepag.com^$third-party
-||lovnxkrszlsb.com^$third-party
-||lovvznyhujf.com^$third-party
-||lpbhbwpbpnl.com^$third-party
-||lpbuaqfgwkzrep.com^$third-party
-||lpbyadpvf.com^$third-party
-||lprkphlgaybvtn.com^$third-party
-||lptggobhuuxcdw.com^$third-party
-||lpxxafsupgsho.com^$third-party
-||lpzsxemf.com^$third-party
-||lqbyqjap.com^$third-party
-||lquodkeqws.com^$third-party
-||lruyzrlcef.com^$third-party
-||lsdgtifuqrwjax.com^$third-party
-||lsmxicydlj.com^$third-party
-||lsooyivois.com^$third-party
-||lstkchbeoey.com^$third-party
-||ltbnvsfzevox.com^$third-party
-||ltvrdftgr.com^$third-party
-||luhbhndh.com^$third-party
-||lusfrsxgxopm.com^$third-party
-||lvcrcimfmfx.com^$third-party
-||lvctzafuvn.com^$third-party
-||lvesmhsex.com^$third-party
-||lvgliqkumatjv.com^$third-party
-||lvldcxnq.com^$third-party
-||lvmnxohz.com^$third-party
-||lvvycndnspeuwo.com^$third-party
-||lwajqohv.com^$third-party
-||lwequndmgc.com^$third-party
-||lwfvrhlqzjseyu.com^$third-party
-||lwtduavwbep.com^$third-party
-||lxcpbfwqagzfz.com^$third-party
-||lxcpprjfgkt.com^$third-party
-||lxelgoqzvjfw.com^$third-party
-||lxlisrvzz.com^$third-party
-||lxnimmyikuekn.com^$third-party
-||lxpgdkskkt.com^$third-party
-||lxwtezlcp.com^$third-party
-||lxyadcffdpaytd.com^$third-party
-||lxymfyptdrast.com^$third-party
-||lxzwknybfvycxr.com^$third-party
-||lybmmxah.com^$third-party
-||lydgyhthfb.com^$third-party
-||lyghoxyxohkrdk.com^$third-party
-||lykuxkxsvvnxqd.com^$third-party
-||lynsvdabds.com^$third-party
-||lyssmgbr.com^$third-party
-||lyyenjcocog.com^$third-party
-||lzkuqbptcjqta.com^$third-party
-||lzopoqzlihfbc.com^$third-party
-||lzscunjyovitc.com^$third-party
-||maidlytsnrn.com^$third-party
-||makumuvgxfogq.com^$third-party
-||marguvpydbrr.com^$third-party
-||mascqybw.com^$third-party
-||mbixofultnnd.com^$third-party
-||mbmjqinvsil.com^$third-party
-||mbmwfufkaxll.com^$third-party
-||mbyrgeoizdid.com^$third-party
-||mcaxqvcu.com^$third-party
-||mcaybfrnrqpmv.com^$third-party
-||mcfdnvewqws.com^$third-party
-||mcgndenytmy.com^$third-party
-||mcnklvsodqqa.com^$third-party
-||mcsnhbdil.com^$third-party
-||mcyopesbusomqf.com^$third-party
-||mczemvlzkndplq.com^$third-party
-||mdlhzknv.com^$third-party
-||mdulmrphzsnvw.com^$third-party
-||mdurqeiydegwzy.com^$third-party
-||mefozykpcwuazw.com^$third-party
-||meguanha.com^$third-party
-||melfljypjydxta.com^$third-party
-||mfgyyqqjpp.com^$third-party
-||mfigasff.com^$third-party
-||mfxjgymma.com^$third-party
-||mfxxpyhzofbsg.com^$third-party
-||mgojnezwuuxyv.com^$third-party
-||mgouoirpayddk.com^$third-party
-||mgpejafvxxn.com^$third-party
-||mguqjbjgs.com^$third-party
-||mgxjvidt.com^$third-party
-||mgyovgqq.com^$third-party
-||mgziozplbkzv.com^$third-party
-||mhfivsdhbpfgk.com^$third-party
-||mhhjdlsnji.com^$third-party
-||mhmgeilfkcgov.com^$third-party
-||mivrpcxlo.com^$third-party
-||mjquyspsrgybs.com^$third-party
-||mkalruavzrtmh.com^$third-party
-||mkxgvmswfmypy.com^$third-party
-||mkzbpsiml.com^$third-party
-||mldsiekmhy.com^$third-party
-||mlgtlxyicweqn.com^$third-party
-||mmpcqstnkcelx.com^$third-party
-||mmsdewfvxhw.com^$third-party
-||mmxbgakffqemu.com^$third-party
-||moginhstnxswt.com^$third-party
-||mogqlceldpwbxe.com^$third-party
-||mojhasmpl.com^$third-party
-||mpfzgidlxsqtyt.com^$third-party
-||mqdznyotsam.com^$third-party
-||mqgvsxqc.com^$third-party
-||mqnklgnucy.com^$third-party
-||mqobpsctcxnbi.com^$third-party
-||mrjzfzwey.com^$third-party
-||mrtehsag.com^$third-party
-||mrzpfpgh.com^$third-party
-||msigpurubzkm.com^$third-party
-||msisvvxmnpm.com^$third-party
-||msmaijsxlo.com^$third-party
-||msoiqafieh.com^$third-party
-||mspnlttfp.com^$third-party
-||mstmrspnqqevsu.com^$third-party
-||msxmfyhwgkos.com^$third-party
-||mtbwqtfqnj.com^$third-party
-||mtdlcstsqt.com^$third-party
-||mtnobdfcgylhuj.com^$third-party
-||mtnreztslx.com^$third-party
-||muasoctv.com^$third-party
-||muoiuxfj.com^$third-party
-||musighkm.com^$third-party
-||muwjxxvovtb.com^$third-party
-||muxtpvixahawy.com^$third-party
-||mvotvznetuvfb.com^$third-party
-||mvqzskrnrsy.com^$third-party
-||mvunstblutptj.com^$third-party
-||mvxhbajzn.com^$third-party
-||mvyctyji.com^$third-party
-||mwfzoumik.com^$third-party
-||mwggummxeygq.com^$third-party
-||mwnhdnkevthkz.com^$third-party
-||mwuiykzqwaic.com^$third-party
-||mxpzslze.com^$third-party
-||mxzxeersjv.com^$third-party
-||mykhtesikvuz.com^$third-party
-||mylhebhwgim.com^$third-party
-||myogwiwjlfrngo.com^$third-party
-||myqvhpjyd.com^$third-party
-||myzsyljf.com^$third-party
-||mzhcaexrrl.com^$third-party
-||mzwaqcfbx.com^$third-party
-||mzxexigxkb.com^$third-party
-||mzzouiciajems.com^$third-party
-||naavxddd.com^$third-party
-||nahixtmnmpcz.com^$third-party
-||nahpewniig.com^$third-party
-||naohofhbprtx.com^$third-party
-||napickmw.com^$third-party
-||nbkcuewy.com^$third-party
-||nbvbblmksiahf.com^$third-party
-||nbxfvfeanq.com^$third-party
-||nbylhvbswplcj.com^$third-party
-||nclfwbnmcrci.com^$third-party
-||ncoibhdzttozh.com^$third-party
-||ncsyyeabk.com^$third-party
-||ndilzwjgblea.com^$third-party
-||ndprxvzgy.com^$third-party
-||ndxtyryloc.com^$third-party
-||neecnuaa.com^$third-party
-||neschaypaxkk.com^$third-party
-||neyenbozrfuocz.com^$third-party
-||nezbumpwtdexd.com^$third-party
-||nfbjwvmndabthb.com^$third-party
-||nfbpcvzj.com^$third-party
-||nfijzdjtpglk.com^$third-party
-||nfnxvdds.com^$third-party
-||nfxzakrvymtuhs.com^$third-party
-||ngfsciiu.com^$third-party
-||ngptxgpbdnutvi.com^$third-party
-||ngymzbpjnqra.com^$third-party
-||nharaeklya.com^$third-party
-||nhkhxvnhfdkn.com^$third-party
-||nhqmomir.com^$third-party
-||nicmtzkucd.com^$third-party
-||nidksyrrrtckzj.com^$third-party
-||nikxhdrys.com^$third-party
-||nirqmbrzplvtjr.com^$third-party
-||njeozjhyjb.com^$third-party
-||njgogjkwlzroh.com^$third-party
-||njxjjvyim.com^$third-party
-||nkfqzyqmkp.com^$third-party
-||nljpyhzkat.com^$third-party
-||nllbirpx.com^$third-party
-||nlnhfsmo.com^$third-party
-||nlteopgkeb.com^$third-party
-||nltzieywjkfb.com^$third-party
-||nlujbqmtgv.com^$third-party
-||nlyqwlyykvjl.com^$third-party
-||nmlvcxad.com^$third-party
-||nmnzukxervpdnx.com^$third-party
-||nmvqhlengcrur.com^$third-party
-||nmwzrcdzbrjj.com^$third-party
-||nmywwgnnkmud.com^$third-party
-||nngfrvcf.com^$third-party
-||nnmgvixuhbqju.com^$third-party
-||nnoxqfmbdv.com^$third-party
-||nnroeulsnslk.com^$third-party
-||nntvphjayapz.com^$third-party
-||nnulezwhvbrzwu.com^$third-party
-||nnvqabkpa.com^$third-party
-||nobpgppgbucy.com^$third-party
-||nofhtrsaz.com^$third-party
-||noiaifyednjt.com^$third-party
-||nolpjfsu.com^$third-party
-||novhyaxaioxaon.com^$third-party
-||nowymmrxj.com^$third-party
-||noxredxaijqdb.com^$third-party
-||npujhntk.com^$third-party
-||nqcqwnvazq.com^$third-party
-||nqlrewsfmywgbx.com^$third-party
-||nqtyrwyklcmh.com^$third-party
-||nqzmumesrbiy.com^$third-party
-||nrcrbfqa.com^$third-party
-||nrgbjgui.com^$third-party
-||nrzhlsvqxbgpbn.com^$third-party
-||nsboaqyssquk.com^$third-party
-||nscjgmhyeov.com^$third-party
-||nstjenxcpvm.com^$third-party
-||nswnseld.com^$third-party
-||ntgqcnferh.com^$third-party
-||nticqzrucdg.com^$third-party
-||ntjcrsfvszoen.com^$third-party
-||ntkuokicthbxc.com^$third-party
-||ntlhrttump.com^$third-party
-||ntoyqqrwrmzr.com^$third-party
-||ntwhbuqmel.com^$third-party
-||nuaycqtaluwha.com^$third-party
-||nudooapfildwbz.com^$third-party
-||numcxvlfguc.com^$third-party
-||nuowoczmvits.com^$third-party
-||nupgypwxcv.com^$third-party
-||nutlekuainya.com^$third-party
-||nuxdkxknj.com^$third-party
-||nuxsmhexm.com^$third-party
-||nvgcmeqfn.com^$third-party
-||nvjjquyylqicp.com^$third-party
-||nvoepbzqtn.com^$third-party
-||nvztwdkbldp.com^$third-party
-||nwazehtl.com^$third-party
-||nwsderzo.com^$third-party
-||nwwuhiukrq.com^$third-party
-||nwxtppuoeycp.com^$third-party
-||nwxwaxhfg.com^$third-party
-||nxewruvxprbd.com^$third-party
-||nxjlnchylgsw.com^$third-party
-||nxnjpslufglmvp.com^$third-party
-||nycnjewyxex.com^$third-party
-||nyltsyud.com^$third-party
-||nypmjsgpmhd.com^$third-party
-||nyskocbhfz.com^$third-party
-||nytqlenw.com^$third-party
-||nyvqazwtcwk.com^$third-party
-||nywpxugigwfzb.com^$third-party
-||nywuthdzdacoq.com^$third-party
-||nzkjbazl.com^$third-party
-||oabcufwk.com^$third-party
-||oaibzaqh.com^$third-party
-||oamhzvwle.com^$third-party
-||oansiwcmc.com^$third-party
-||oarqgvtkco.com^$third-party
-||oartozvwzv.com^$third-party
-||obczphph.com^$third-party
-||obeeifroxtivh.com^$third-party
-||obpzuctfozram.com^$third-party
-||obwvmzdb.com^$third-party
-||obyxqjgwg.com^$third-party
-||ocejkjkopphj.com^$third-party
-||oceuwezutqfcbx.com^$third-party
-||ocfsmefzzarkmo.com^$third-party
-||ocixtsnyxxvyaw.com^$third-party
-||ocrwyhamhfpfc.com^$third-party
-||odanetrlgvunth.com^$third-party
-||odezwmru.com^$third-party
-||odlkdyoe.com^$third-party
-||ododtktl.com^$third-party
-||odukhsymyua.com^$third-party
-||oebdarcqsqcdk.com^$third-party
-||oeevatisopdl.com^$third-party
-||oeidusggzj.com^$third-party
-||oeppesfmzlbpa.com^$third-party
-||oertmxfsryji.com^$third-party
-||oezgivtasc.com^$third-party
-||ofdfinqurwpi.com^$third-party
-||ofrducrisy.com^$third-party
-||ogisrmbhajhyam.com^$third-party
-||ogjascdgq.com^$third-party
-||ognybevu.com^$third-party
-||ogqclfvaq.com^$third-party
-||ogqewglysfc.com^$third-party
-||ogyhsyuhczvjg.com^$third-party
-||ohleiludieje.info^$third-party
-||ohrdpvkzhzbg.com^$third-party
-||oijjptnwrg.com^$third-party
-||oimpkumntje.com^$third-party
-||oinqqbzs.com^$third-party
-||oiumoqzo.com^$third-party
-||oixisqtlbhygp.com^$third-party
-||ojbevkqot.com^$third-party
-||ojntbybxh.com^$third-party
-||ojsfjyekvmyb.com^$third-party
-||okffuzmscjboad.com^$third-party
-||okoufwmfzujsf.com^$third-party
-||olgjzpgp.com^$third-party
-||olrznxrgkym.com^$third-party
-||omakfhugexq.com^$third-party
-||onocjgpq.com^$third-party
-||oofpjjtc.com^$third-party
-||ookiqhfioldxwj.com^$third-party
-||ootqfqjhzfrtn.com^$third-party
-||oounzfsyxiuj.com^$third-party
-||ooutqfslr.com^$third-party
-||opbneuozwyuvpk.com^$third-party
-||opcyvbwkbiaqyt.com^$third-party
-||opflriars.com^$third-party
-||opfrjkmmvqmm.com^$third-party
-||oseqbfjtsdz.com^$third-party
-||otdgnmvw.com^$third-party
-||otoxkqlivsqr.com^$third-party
-||otruzjgxof.com^$third-party
-||otuveoqm.com^$third-party
-||oucywciij.com^$third-party
-||ouhdgmzajfaop.com^$third-party
-||ounyrilukncbj.com^$third-party
-||ouzqwetenps.com^$third-party
-||ovckindyf.com^$third-party
-||ovczxzkfkfbb.com^$third-party
-||ovgepsxx.com^$third-party
-||ovkihcbxsbfeo.com^$third-party
-||ovmeaxabvfor.com^$third-party
-||owcdycko.com^$third-party
-||owoeaicjtds.com^$third-party
-||owqhtqryzggt.com^$third-party
-||oxcpvsxgegd.com^$third-party
-||oxpvwliy.com^$third-party
-||oxzffweyw.com^$third-party
-||oybahnktadxjju.com^$third-party
-||oyiqurfqulhuq.com^$third-party
-||oylqnzunnw.com^$third-party
-||oynmftlgufr.com^$third-party
-||ozafaszolf.com^$third-party
-||paecbeeavmopbl.com^$third-party
-||paegcsvchsdlbj.com^$third-party
-||pagaynrbee.com^$third-party
-||paysoxemgjqp.com^$third-party
-||pbofytmakvye.com^$third-party
-||pbpdgojwzfdc.com^$third-party
-||pbttxbna.com^$third-party
-||pcbfhotfyuyg.com^$third-party
-||pcdzsowmktz.com^$third-party
-||pcfobwzmlts.com^$third-party
-||pchijkkms.com^$third-party
-||pckbizoed.com^$third-party
-||pdapmkivb.com^$third-party
-||pdnoucwb.com^$third-party
-||pdoijgyoxcjob.com^$third-party
-||pegfkacjwjca.com^$third-party
-||pejhnrurllsq.com^$third-party
-||petsarlaaafru.com^$third-party
-||pewdewgeehc.com^$third-party
-||pewgnvqixnhvij.com^$third-party
-||peyttlwbznahi.com^$third-party
-||pfdctvdgjw.com^$third-party
-||pfihfdmwdsjum.com^$third-party
-||pfiuzxey.com^$third-party
-||pfmoriuywsl.com^$third-party
-||pfoohjpdbxt.com^$third-party
-||pfpkzjwi.com^$third-party
-||pfvfwielz.com^$third-party
-||pfxcnvjoysztb.com^$third-party
-||pgfxwbgema.com^$third-party
-||pgnjgjiwomgdmn.com^$third-party
-||pgpfdravejq.com^$third-party
-||pgpszwldfpc.com^$third-party
-||phhigelii.com^$third-party
-||phiubpdrh.com^$third-party
-||phragnmpo.com^$third-party
-||phskaieua.com^$third-party
-||pidbbdxixp.com^$third-party
-||pifsistcwycouc.com^$third-party
-||piifwkvdil.com^$third-party
-||pimygjumeyrtxe.com^$third-party
-||pipiryiqu.com^$third-party
-||piqvuvqc.com^$third-party
-||pismvlkq.com^$third-party
-||pitduougk.com^$third-party
-||piuhqbchk.com^$third-party
-||pjbifjjtir.com^$third-party
-||pjhwhxmzefjgn.com^$third-party
-||pjyuftrh.com^$third-party
-||pkitdifnkz.com^$third-party
-||pknzoizczuhjvk.com^$third-party
-||pkvhprfhbtft.com^$third-party
-||pkxquvydrgin.com^$third-party
-||plhvzqkkirw.com^$third-party
-||pllregftgbgmdi.com^$third-party
-||plxtejszb.com^$third-party
-||plzjcnyxcdl.com^$third-party
-||pmdgwnsgucy.com^$third-party
-||pmjwztzpuhb.com^$third-party
-||pmohsibnim.com^$third-party
-||pmoucikneuxcxy.com^$third-party
-||pncbscbuzss.com^$third-party
-||pnobsmeio.com^$third-party
-||pnwhrmyit.com^$third-party
-||pnzchguyctrsyb.com^$third-party
-||pogdlwpmck.com^$third-party
-||postrsyk.com^$third-party
-||povqrvsoljy.com^$third-party
-||ppbvmesssyacij.com^$third-party
-||ppgzokht.com^$third-party
-||ppikspdz.com^$third-party
-||pprcfwhlmtagay.com^$third-party
-||ppvlukah.com^$third-party
-||ppxoxkdpxtu.com^$third-party
-||pqajjgjg.com^$third-party
-||pqgslqshlj.com^$third-party
-||pqkorfrurnn.com^$third-party
-||pquuiokltzjpeg.com^$third-party
-||prctxexizzpp.com^$third-party
-||prcymjchczmbjj.com^$third-party
-||prgncwamr.com^$third-party
-||prulogzjtyksnh.com^$third-party
-||ps7894.com^$third-party
-||psborsxlcorxuq.com^$third-party
-||psxxbhheqxoy.com^$third-party
-||ptarywzhyzri.com^$third-party
-||ptiniretm.com^$third-party
-||ptkgzsqf.com^$third-party
-||ptrahwwg.com^$third-party
-||ptvcfltikpdi.com^$third-party
-||ptxqjyqhscs.com^$third-party
-||ptyezfyxcaeu.com^$third-party
-||ptzljkufu.com^$third-party
-||pvpqgjkgvszq.com^$third-party
-||pvumxwnriy.com^$third-party
-||pvuqahjiburadw.com^$third-party
-||pwaqmmquztyne.com^$third-party
-||pwlqrkgkk.com^$third-party
-||pxcveedcuzy.com^$third-party
-||pxiqcfkbxof.com^$third-party
-||pxjmdtryd.com^$third-party
-||pxlqyrteuuh.com^$third-party
-||pxphhwnmwuey.com^$third-party
-||pxthyfgzm.com^$third-party
-||pxzacgmr.com^$third-party
-||pyfmxzhrnivq.com^$third-party
-||pyhtclpgzbe.com^$third-party
-||pyllxjfkjhpjbq.com^$third-party
-||pyqwtxicjodcij.com^$third-party
-||pyubjvvdsrja.com^$third-party
-||pzbqocjaphp.com^$third-party
-||pzfittkdqrrsa.com^$third-party
-||pzjdrhrlzdli.com^$third-party
-||pzopzjlhqbkgnp.com^$third-party
-||pzszpntjlz.com^$third-party
-||pzzmqjrp.com^$third-party
-||qaiqromd.com^$third-party
-||qaxtgbdxjpibc.com^$third-party
-||qbjnwjtbfrxceq.com^$third-party
-||qbldzsktv.com^$third-party
-||qbsanzpkfj.com^$third-party
-||qbtfmtuixtmep.com^$third-party
-||qbttelbrupkss.com^$third-party
-||qbwjddqa.com^$third-party
-||qcaejiouuvgk.com^$third-party
-||qceixjlqe.com^$third-party
-||qcexplnqbrral.com^$third-party
-||qczvjjdbaj.com^$third-party
-||qdgpsfmg.com^$third-party
-||qdjnwlrjllti.com^$third-party
-||qdpxpnmh.com^$third-party
-||qduijsyonrmfke.com^$third-party
-||qefyaspzyhcb.com^$third-party
-||qenprsuoashu.com^$third-party
-||qeobhjit.com^$third-party
-||qevmzohvwxesrd.com^$third-party
-||qezcdxxskinzi.com^$third-party
-||qfcsljgckvpz.com^$third-party
-||qfedsccxccfzut.com^$third-party
-||qfpqfdbjyjmvv.com^$third-party
-||qfpqmxkiwh.com^$third-party
-||qfqtufbrfdpbw.com^$third-party
-||qfsutura.com^$third-party
-||qfypbqbumu.com^$third-party
-||qgawivqfotfyrw.com^$third-party
-||qgbjchbl.com^$third-party
-||qgcliwoxgdptz.com^$third-party
-||qgdqujzzs.com^$third-party
-||qgeglsnoxk.com^$third-party
-||qgnakeddgtdw.com^$third-party
-||qgpmtdrm.com^$third-party
-||qgslgwfxar.com^$third-party
-||qgxrmkbzpm.com^$third-party
-||qhpwanmnbvkiio.com^$third-party
-||qhqrtjgsnu.com^$third-party
-||qhuktypo.com^$third-party
-||qhzvvwblzrjc.com^$third-party
-||qinytcise.com^$third-party
-||qirnhdcywjnd.com^$third-party
-||qjgqelsvt.com^$third-party
-||qjlgyiuesk.com^$third-party
-||qjmkidiwbndolx.com^$third-party
-||qjttowndvet.com^$third-party
-||qjuzjpkihvya.com^$third-party
-||qjvullwjz.com^$third-party
-||qjvzbfym.com^$third-party
-||qjwkyhlxa.com^$third-party
-||qkmvpyujof.com^$third-party
-||qknfsqxxm.com^$third-party
-||qksihowyv.com^$third-party
-||qkwbygfsbfmj.com^$third-party
-||qkyzjwhyeh.com^$third-party
-||qlatsfeyg.com^$third-party
-||qlmgmgvmiepsb.com^$third-party
-||qlxwtwasgmdf.com^$third-party
-||qlyfjtkl.com^$third-party
-||qmiiqzfk.com^$third-party
-||qmmdvzsebi.com^$third-party
-||qnfpskgtzkw.com^$third-party
-||qnhwhedcrzeodd.com^$third-party
-||qnjdtefk.com^$third-party
-||qnzelsgj.com^$third-party
-||qoayrejue.com^$third-party
-||qofzhmbqa.com^$third-party
-||qoiagrfbmquek.com^$third-party
-||qolrlwwirf.com^$third-party
-||qopqudzeaywc.com^$third-party
-||qosrridifvsr.com^$third-party
-||qouiruhpxoa.com^$third-party
-||qowmqduocv.com^$third-party
-||qoxcijqqkyeob.com^$third-party
-||qoyagwzholjofg.com^$third-party
-||qpbaammdcwu.com^$third-party
-||qpganepbkw.com^$third-party
-||qpkyqrafgsacm.com^$third-party
-||qplcqdbiob.com^$third-party
-||qpmswrurt.com^$third-party
-||qpqnbnsnosdss.com^$third-party
-||qqcbzxwzpmzdcd.com^$third-party
-||qqcjvbsd.com^$third-party
-||qqkxrlzaaul.com^$third-party
-||qqtqicbvrwg.com^$third-party
-||qquwjmmgtmle.com^$third-party
-||qrecxvdoewmztq.com^$third-party
-||qrirkdzdxtxc.com^$third-party
-||qrwlerqenp.com^$third-party
-||qsfogpmciyl.com^$third-party
-||qsnzncerqgack.com^$third-party
-||qsoetgedlgyhyz.com^$third-party
-||qtahsbgdqbu.com^$third-party
-||qtbvatpkwxq.com^$third-party
-||qtgarolvaigptk.com^$third-party
-||qtjxalkllc.com^$third-party
-||qtsyxyakun.com^$third-party
-||qtuckpvttvikd.com^$third-party
-||qtwadryxicx.com^$third-party
-||qtxihhkvln.com^$third-party
-||quazhzeih.com^$third-party
-||qukqptxilr.com^$third-party
-||qunnvfhdgfm.com^$third-party
-||qupiinlyjuf.com^$third-party
-||qurhdjkms.com^$third-party
-||quyxxofx.com^$third-party
-||qvgjqhfnbdeur.com^$third-party
-||qvilmdus.com^$third-party
-||qvivzreleolawc.com^$third-party
-||qvsshkcr.com^$third-party
-||qwittqgogiip.com^$third-party
-||qwuejlmct.com^$third-party
-||qwuexgqmua.com^$third-party
-||qwuxwxdr.com^$third-party
-||qwzhaqtbiygid.com^$third-party
-||qxamtnrwxjyy.com^$third-party
-||qxboqjnmxv.com^$third-party
-||qxcibgzsxegxc.com^$third-party
-||qxmecqgzrgdh.com^$third-party
-||qxykytqzwagqj.com^$third-party
-||qybzvfvqzpmxpu.com^$third-party
-||qydylxmzlnqw.com^$third-party
-||qyfunsvmtudozq.com^$third-party
-||qyifxakawscsyd.com^$third-party
-||qyiiudex.com^$third-party
-||qyillxuyjdlmh.com^$third-party
-||qyqbslpprlph.com^$third-party
-||qyqvfjvbzosz.com^$third-party
-||qyrzcsoaey.com^$third-party
-||qytabshszekf.com^$third-party
-||qytuwxcozbk.com^$third-party
-||qzbnokxxvvpwf.com^$third-party
-||qzfnuwdc.com^$third-party
-||qzhaqsxb.com^$third-party
-||qzismxssqf.com^$third-party
-||qzizjjyvsa.com^$third-party
-||rabjkklvegagrn.com^$third-party
-||rahvoujjgmtvft.com^$third-party
-||raqucjjblu.com^$third-party
-||rbbesmzvokpste.com^$third-party
-||rbefggthfx.com^$third-party
-||rbfgsoanxw.com^$third-party
-||rbnjngtbpwbk.com^$third-party
-||rbrpamcygqplm.com^$third-party
-||rbtpsbtzh.com^$third-party
-||rbtqofrkiixz.com^$third-party
-||rcudacimrqdlk.com^$third-party
-||rcumwyqkv.com^$third-party
-||rcvhzfcnja.com^$third-party
-||rdfpnzisjyiwtu.com^$third-party
-||rdizmyst.com^$third-party
-||rdoovrzqazvpgv.com^$third-party
-||rdooybwcuyg.com^$third-party
-||rdrkxlmlqpqns.com^$third-party
-||rdwcvesg.com^$third-party
-||realnwspfbumn.com^$third-party
-||refatxhcuu.com^$third-party
-||regqrfuvncqcm.com^$third-party
-||reiqwxxd.com^$third-party
-||relnocyyxhpjb.com^$third-party
-||rereghpaz.com^$third-party
-||reszkzmyzceve.com^$third-party
-||reztksclx.com^$third-party
-||rfbmtfebfcwlgo.com^$third-party
-||rfcsmdodviqhn.com^$third-party
-||rfcxwidka.com^$third-party
-||rfgldefouazmj.com^$third-party
-||rfmbvlaphdud.com^$third-party
-||rfmtxdjulpdb.com^$third-party
-||rfpnlsbbu.com^$third-party
-||rfrsnqen.com^$third-party
-||rgejlqtlr.com^$third-party
-||rgvrddwoccsgn.com^$third-party
-||rhqrfnkngrhrha.com^$third-party
-||rhypgggd.com^$third-party
-||rhzpcnueogbexb.com^$third-party
-||rigoczly.com^$third-party
-||rigybdgiubwqg.com^$third-party
-||rixxvqexdlgrl.com^$third-party
-||rjeksrigwzm.com^$third-party
-||rjirxadtq.com^$third-party
-||rjszckwlctpup.com^$third-party
-||rjveitlz.com^$third-party
-||rjwdhpxdrufbcg.com^$third-party
-||rkcxzwlkk.com^$third-party
-||rkczvumivvb.com^$third-party
-||rkgznnhikrfphq.com^$third-party
-||rkueifizvmwbi.com^$third-party
-||rlgungosm.com^$third-party
-||rljakgkixu.com^$third-party
-||rlomrjxrpsev.com^$third-party
-||rlsqhgku.com^$third-party
-||rmhdjambba.com^$third-party
-||rmjwdosemtg.com^$third-party
-||rmwjtqazyk.com^$third-party
-||rnagwksouk.com^$third-party
-||rniiylqxvxybv.com^$third-party
-||rnlfitypkucbhi.com^$third-party
-||rnzgebpy.com^$third-party
-||roibwbjaclwgg.com^$third-party
-||ropkrhilt.com^$third-party
-||rouvpebtazdlq.com^$third-party
-||rpcncuzsmpni.com^$third-party
-||rpnhxhzcejyiym.com^$third-party
-||rpzcwgrpbkltp.com^$third-party
-||rqaobxvj.com^$third-party
-||rqbxfbls.com^$third-party
-||rqigvkwoqafpjz.com^$third-party
-||rqndohbkuer.com^$third-party
-||rquagrre.com^$third-party
-||rqwozrkmtwiuri.com^$third-party
-||rqxjnkgcobp.com^$third-party
-||rqxwisgin.com^$third-party
-||rqyoulixflzbe.com^$third-party
-||rrnqzntj.com^$third-party
-||rroyintwabqyua.com^$third-party
-||rrvpscehvjuz.com^$third-party
-||rsbblrpnjxgsk.com^$third-party
-||rscqizsukecevh.com^$third-party
-||rsguboxyb.com^$third-party
-||rsiyppewvonkc.com^$third-party
-||rssgflbj.com^$third-party
-||rstjainimptgn.com^$third-party
-||rtdogcdkovndho.com^$third-party
-||rubfwmlm.com^$third-party
-||rubxajsomnicfy.com^$third-party
-||rukwbbwcil.com^$third-party
-||runwtxeisppmt.com^$third-party
-||ruodzaboyf.com^$third-party
-||rvtxrtzbswdji.com^$third-party
-||rvyvkjqffmdp.com^$third-party
-||rwalomjwgyljqj.com^$third-party
-||rwgvulisul.com^$third-party
-||rwkxvess.com^$third-party
-||rwphwhdoktfq.com^$third-party
-||rwugdvqdpxfz.com^$third-party
-||rwugglxboxgw.com^$third-party
-||rxbbddhkl.com^$third-party
-||rxgbytxipwa.com^$third-party
-||rxhicseychr.com^$third-party
-||rxysradiyvcp.com^$third-party
-||ryrrhgpmlif.com^$third-party
-||ryybhoklizmuew.com^$third-party
-||rzfldcrlwe.com^$third-party
-||rzizcnhoobxw.com^$third-party
-||rzjhxwfbxp.com^$third-party
-||rzmrzylebgq.com^$third-party
-||rzuwelgm.com^$third-party
-||saenrwiqesp.com^$third-party
-||sawdfbwxqcpcs.com^$third-party
-||sbealpvjpzzs.com^$third-party
-||sbifdctojpisuw.com^$third-party
-||sbkjxpwxrmk.com^$third-party
-||sbmdsfld.com^$third-party
-||sbmijpifoszz.com^$third-party
-||sbopaitvwpzilp.com^$third-party
-||sbudbyidtdrgey.com^$third-party
-||scjczeqyuqjs.com^$third-party
-||sckzvqadc.com^$third-party
-||scsklzqwme.com^$third-party
-||sczcxmaizy.com^$third-party
-||sdeadbqsjam.com^$third-party
-||sdtqotoe.com^$third-party
-||sdzxojlt.com^$third-party
-||secfpgpqx.com^$third-party
-||seoaelrfdy.com^$third-party
-||sepyqhipq.com^$third-party
-||seuojaesymeriv.com^$third-party
-||sfgkhgfdsochwd.com^$third-party
-||sfhrxcbbmtfqw.com^$third-party
-||sfmgzvam.com^$third-party
-||sfrsuihcubepzd.com^$third-party
-||sfxmdqbi.com^$third-party
-||sgggjaosyrxr.com^$third-party
-||sgiueejx.com^$third-party
-||sgrreqyxvigwuh.com^$third-party
-||sgxaqysyilwkiu.com^$third-party
-||sgzlmagzrrk.com^$third-party
-||shacupwelhehqc.com^$third-party
-||shapzwwy.com^$third-party
-||shasnvadkustw.com^$third-party
-||shgvuhvf.com^$third-party
-||shkfrsif.com^$third-party
-||shldethxhl.com^$third-party
-||shmpdqwucl.com^$third-party
-||shohabiymgjxdb.com^$third-party
-||siaiscphvghttd.com^$third-party
-||sicpkohkcmt.com^$third-party
-||sicteppojdwr.com^$third-party
-||sihciabzm.com^$third-party
-||sihjnaojbrs.com^$third-party
-||sinyfqrmiqgd.com^$third-party
-||siqcrwlrqjc.com^$third-party
-||sisrgcvomn.com^$third-party
-||sisyqzktimhrgo.com^$third-party
-||sivqblzejhx.com^$third-party
-||sjqpctsz.com^$third-party
-||sjwdbzsa.com^$third-party
-||skcyigichh.com^$third-party
-||skgnompyiusim.com^$third-party
-||sksalqvpoc.com^$third-party
-||skspurybnv.com^$third-party
-||skzpsnpp.com^$third-party
-||slwclrwmruuxav.com^$third-party
-||smapohsnoww.com^$third-party
-||smnkyzqzfxk.com^$third-party
-||smpbzsjpk.com^$third-party
-||smuucatbrc.com^$third-party
-||snfhwcvdqxioj.com^$third-party
-||snrmqtnnlxdgdh.com^$third-party
-||snsfjpes.com^$third-party
-||snsgsqyv.com^$third-party
-||snxvrnhe.com^$third-party
-||soehcsryxyd.com^$third-party
-||soeovckk.com^$third-party
-||sosbyncpkyw.com^$third-party
-||spwssohsyqgq.com^$third-party
-||sqnkkpba.com^$third-party
-||sqsdyfgyjdjbx.com^$third-party
-||srgszwexkpehb.com^$third-party
-||srhovuokux.com^$third-party
-||ssdsylfzav.com^$third-party
-||ssigftlcuc.com^$third-party
-||ssjgkyyrqiwjol.com^$third-party
-||ssqzsdcnoqv.com^$third-party
-||stekcwrdwohbch.com^$third-party
-||sthtrtvkkt.com^$third-party
-||stvayyokjvxnl.com^$third-party
-||sudolljkjzxdfc.com^$third-party
-||sueolwxxosqch.com^$third-party
-||sukgtuksypr.com^$third-party
-||sumizxwhfsrke.com^$third-party
-||sumsmoxssy.com^$third-party
-||svbsvbwci.com^$third-party
-||svdmxetbyfyg.com^$third-party
-||svfqoztfopv.com^$third-party
-||svmtvfuok.com^$third-party
-||svntdcuxobohs.com^$third-party
-||swcuxrfitmjfee.com^$third-party
-||swezbddhwcz.com^$third-party
-||swmwgptzlgsc.com^$third-party
-||swpopynngk.com^$third-party
-||sxedqvvaxxj.com^$third-party
-||sxgmppxfts.com^$third-party
-||sxhpwsgdyhw.com^$third-party
-||sxmmgiuilt.com^$third-party
-||syhjnolp.com^$third-party
-||syicirtpxosk.com^$third-party
-||symydvmqjjp.com^$third-party
-||szlkqxlkcz.com^$third-party
-||szxnruaeuig.com^$third-party
-||tadaeizih.com^$third-party
-||tadozqgv.com^$third-party
-||tamrczjeedauh.com^$third-party
-||taqesyqne.com^$third-party
-||tarxjwdkx.com^$third-party
-||tasvjsmnegj.com^$third-party
-||tbkfmuvtzrwsw.com^$third-party
-||tblaqgify.com^$third-party
-||tbmwhcyfapzjre.com^$third-party
-||tbnnsmwfjzttct.com^$third-party
-||tbnyxepibups.com^$third-party
-||tbrzzxyvkz.com^$third-party
-||tbupszmmzn.com^$third-party
-||tbxvgojzcbxpoc.com^$third-party
-||tcovxxenhjke.com^$third-party
-||tcwcsaddht.com^$third-party
-||tczvikamowfjte.com^$third-party
-||tdjfxeavusdpci.com^$third-party
-||tdjoaosibes.com^$third-party
-||teefpagayhb.com^$third-party
-||tehkvecryl.com^$third-party
-||teipgupp.com^$third-party
-||tektbzadrceqje.com^$third-party
-||tepazmynhvo.com^$third-party
-||tfhuupltipcg.com^$third-party
-||tfijbdegozfh.com^$third-party
-||tfjfcvhvudxf.com^$third-party
-||tfqexqeldxjvet.com^$third-party
-||tfxorvbelxfbmk.com^$third-party
-||tfyxcbougqvmk.com^$third-party
-||tgkcxtvryb.com^$third-party
-||tgugqkjvinvgv.com^$third-party
-||tgujinopirjgnn.com^$third-party
-||tguzugtyoh.com^$third-party
-||thbuhcnpt.com^$third-party
-||thivsxubn.com^$third-party
-||thjlnyagmxrbt.com^$third-party
-||thqwivyhdpoem.com^$third-party
-||tibzpgmogjqa.com^$third-party
-||ticpqxnv.com^$third-party
-||tielsdhblnmiv.com^$third-party
-||tifzusomh.com^$third-party
-||tikjbfpd.com^$third-party
-||tiphkuloov.com^$third-party
-||tiptwfbksobui.com^$third-party
-||tjdrxdsto.com^$third-party
-||tjtukeaszrqco.com^$third-party
-||tjyoznaozivi.com^$third-party
-||tkewsaesxhf.com^$third-party
-||tkhoazslm.com^$third-party
-||tkncbgwor.com^$third-party
-||tktyinaabq.com^$third-party
-||tlecwkrygjas.com^$third-party
-||tmhgsorajits.com^$third-party
-||tmmpiibtfi.com^$third-party
-||tmrsjdxavhjgww.com^$third-party
-||tnacywet.com^$third-party
-||tnlfupvrlr.com^$third-party
-||tnlshxmc.com^$third-party
-||tnvghrlg.com^$third-party
-||tnwjldvivhgr.com^$third-party
-||tnznswilqtni.com^$third-party
-||tphwlmybvamq.com^$third-party
-||tpjhxvondqzult.com^$third-party
-||tpnaabdwy.com^$third-party
-||tptfopotrzg.com^$third-party
-||tqixovpneycfmk.com^$third-party
-||tqlypenbt.com^$third-party
-||tqmricveyxphfo.com^$third-party
-||tqomajswbm.com^$third-party
-||tqtqneoybxzpoh.com^$third-party
-||trbucgmbren.com^$third-party
-||trcrkykttaila.com^$third-party
-||trdmnpklszd.com^$third-party
-||trgdwwhaa.com^$third-party
-||tricsdqejmu.com^$third-party
-||trjmgercl.com^$third-party
-||tsdzmkpewrdxyl.com^$third-party
-||tsmdmunzbtu.com^$third-party
-||ttdtuwbxgyveg.com^$third-party
-||ttegjzxzxyetf.com^$third-party
-||ttgvmqdpomt.com^$third-party
-||tthvomis.com^$third-party
-||ttomktasfnqlg.com^$third-party
-||ttulyfbkatyzp.com^$third-party
-||tufpmrcdc.com^$third-party
-||tuggbdzprgudk.com^$third-party
-||tuliprfawfq.com^$third-party
-||tuxbpnne.com^$third-party
-||tuxgnhcrhyugjf.com^$third-party
-||tuzmouxn.com^$third-party
-||tuzvjlqrpzpugj.com^$third-party
-||tvevyrrrnbcbyk.com^$third-party
-||tvjkilgfanpt.com^$third-party
-||tvlubtrxcold.com^$third-party
-||tvvozxml.com^$third-party
-||tvwewigpqjj.com^$third-party
-||twfilnym.com^$third-party
-||twiyetehf.com^$third-party
-||twnkpjhbgcp.com^$third-party
-||twzfqxmt.com^$third-party
-||txwdabikzvw.com^$third-party
-||txyylwegpdfsda.com^$third-party
-||tyavjmvuvygs.com^$third-party
-||tyccaweownne.com^$third-party
-||tylzbdkjsjig.com^$third-party
-||tyuawmgqsbz.com^$third-party
-||tzbdudhsip.com^$third-party
-||tzfywuot.com^$third-party
-||tzyvolvenvyim.com^$third-party
-||uabdikmdwqdbr.com^$third-party
-||uafgymcern.com^$third-party
-||uamgajydnv.com^$third-party
-||uaneklzqph.com^$third-party
-||uanomwcxixed.com^$third-party
-||uaofcvzlhhh.com^$third-party
-||uaolighevmjy.com^$third-party
-||ubdudsdfcll.com^$third-party
-||ubjapvhzffdreq.com^$third-party
-||ubjnuclsgxu.com^$third-party
-||ubpjjgso.com^$third-party
-||ubusbjjd.com^$third-party
-||ubvyjgbdiq.com^$third-party
-||ubwzawpqlsk.com^$third-party
-||uchiytqiuir.com^$third-party
-||uclylhzwg.com^$third-party
-||ucozssymgw.com^$third-party
-||ucvrtwfh.com^$third-party
-||uczaqrjgkztxe.com^$third-party
-||udvysuucqgadg.com^$third-party
-||uembrcfeuwtsjy.com^$third-party
-||uemjnvyn.com^$third-party
-||uenpibqyjvim.com^$third-party
-||uescuqejoirsh.com^$third-party
-||ufelatujvbhtbo.com^$third-party
-||ufnozeotbqsn.com^$third-party
-||ufptmejous.com^$third-party
-||ufrbfvelweoy.com^$third-party
-||ufugfbtpp.com^$third-party
-||ugkppchlelde.com^$third-party
-||ugoptxnm.com^$third-party
-||ugwkyqdbmpwbbi.com^$third-party
-||ugzpvflxa.com^$third-party
-||uhicnlmab.com^$third-party
-||uhyyacioq.com^$third-party
-||uigruwtql.com^$third-party
-||uimrmuoztkoia.com^$third-party
-||uisdjvwytl.com^$third-party
-||uisrihozphejjt.com^$third-party
-||ujpakyfu.com^$third-party
-||ujrtwvabum.com^$third-party
-||ujwdwwfuqcgnv.com^$third-party
-||ukdjbubvp.com^$third-party
-||ukjsibgu.com^$third-party
-||ukksghzwxha.com^$third-party
-||ukpdcsfermd.com^$third-party
-||ukrzsrrydyysim.com^$third-party
-||ullariwoi.com^$third-party
-||ulrryqpp.com^$third-party
-||ultjaimlrjlfl.com^$third-party
-||umaglven.com^$third-party
-||umqhjmowzjrl.com^$third-party
-||umvgcqaxmie.com^$third-party
-||undoxiraqm.com^$third-party
-||unikmmqybjy.com^$third-party
-||unkrokwhwn.com^$third-party
-||unmdrnuzgel.com^$third-party
-||unrzhgdly.com^$third-party
-||unyhjoehc.com^$third-party
-||uoapkzwkoqnk.com^$third-party
-||uoccvsdh.com^$third-party
-||uohpnvpynvsz.com^$third-party
-||uoicsyuiof.com^$third-party
-||uoifloesog.com^$third-party
-||uopayiycy.com^$third-party
-||upckrtagwpwk.com^$third-party
-||uppybbhxbblxa.com^$third-party
-||uprbleorptdghy.com^$third-party
-||upzpyrsvvxpoey.com^$third-party
-||uqbxjdeeq.com^$third-party
-||uqemcyylvcdrgs.com^$third-party
-||uqihbnpqtwwzdv.com^$third-party
-||uqmkkfaoqnnmlx.com^$third-party
-||uqouplgwlmeqt.com^$third-party
-||uqyirvghv.com^$third-party
-||urfdvrrg.com^$third-party
-||uryvzhvgpulaog.com^$third-party
-||usclxdvvvnkdrv.com^$third-party
-||usdlgonjnzpu.com^$third-party
-||usfmamdapvmfs.com^$third-party
-||usfmwydo.com^$third-party
-||usvgzajftrzkr.com^$third-party
-||uswgkadyika.com^$third-party
-||utbclxmcv.com^$third-party
-||uthifuehb.com^$third-party
-||utiiamqdsku.com^$third-party
-||utmcttmdaoqd.com^$third-party
-||utuqrzwg.com^$third-party
-||utvxgpmcnaq.com^$third-party
-||utxatnjs.com^$third-party
-||utzhcsrzrlhhxn.com^$third-party
-||uuaajohul.com^$third-party
-||uubxhbwnwmfqp.com^$third-party
-||uuzjerqlmxnosw.com^$third-party
-||uvlyzxml.com^$third-party
-||uvniygdwmoojfm.com^$third-party
-||uvomthuqsqx.com^$third-party
-||uvppdseel.com^$third-party
-||uvyfszshvgassp.com^$third-party
-||uvzfodimtska.com^$third-party
-||uwidtpjwh.com^$third-party
-||uwkwhedvie.com^$third-party
-||uwxldrvqyk.com^$third-party
-||uxkkltrrxlowzo.com^$third-party
-||uxnssjly.com^$third-party
-||uyeluxauiq.com^$third-party
-||uymxsbbh.com^$third-party
-||uytabzmvei.com^$third-party
-||uyxjfkgudefv.com^$third-party
-||uyznjuyfyjc.com^$third-party
-||uzlleehrsmibli.com^$third-party
-||uzrrqqzlktpymn.com^$third-party
-||uzvuhhyymmkc.com^$third-party
-||uzxyqxolrc.com^$third-party
-||uzxzkkyzb.com^$third-party
-||uzylpwfamhcb.com^$third-party
-||vajiyqbb.com^$third-party
-||vapgfhsecbit.com^$third-party
-||vasfxpribls.com^$third-party
-||vaslssynz.com^$third-party
-||vbdrzplqtgk.com^$third-party
-||vbguaqweaif.com^$third-party
-||vbiudrdieouauc.com^$third-party
-||vbjpddtj.com^$third-party
-||vbqcwfleda.com^$third-party
-||vbuhzjnj.com^$third-party
-||vbwakfbazxd.com^$third-party
-||vbwfqaisbgn.com^$third-party
-||vbxrcekqkmrzyd.com^$third-party
-||vcfnspbgztl.com^$third-party
-||vcvapkiua.com^$third-party
-||vcwrigdrnh.com^$third-party
-||vcxoizuwy.com^$third-party
-||vcyxvhxysl.com^$third-party
-||vczprcezg.com^$third-party
-||vdbasihbxwea.com^$third-party
-||vdldsjqxppi.com^$third-party
-||vebubhzj.com^$third-party
-||veedjtyvhn.com^$third-party
-||velfssiowmyos.com^$third-party
-||vemrhavwgchp.com^$third-party
-||veoujrnenng.com^$third-party
-||vepatyei.com^$third-party
-||vewpwrqebmwu.com^$third-party
-||vezipelsr.com^$third-party
-||vfgbeaayncdya.com^$third-party
-||vfkuauks.com^$third-party
-||vfnemtpehzmzwc.com^$third-party
-||vgjwkjinwkud.com^$third-party
-||vglpukrekfij.com^$third-party
-||vgogzrukn.com^$third-party
-||vgyakiejafjjj.com^$third-party
-||vhbyakilp.com^$third-party
-||vhdvllhgyrjy.com^$third-party
-||vhiuhrwapdirpu.com^$third-party
-||vhzgmzakn.com^$third-party
-||vickgdkdrwpdt.com^$third-party
-||viphdsrlec.com^$third-party
-||virgbmkmear.com^$third-party
-||viwsqbbvfknp.com^$third-party
-||vjcewkcjqu.com^$third-party
-||vjfkglkztcz.com^$third-party
-||vjgyxegvfrhthq.com^$third-party
-||vjltrbzrtqmkib.com^$third-party
-||vjzcgotoy.com^$third-party
-||vkhrnisuky.com^$third-party
-||vkrgljxqn.com^$third-party
-||vletnguozhvm.com^$third-party
-||vlhdmywfi.com^$third-party
-||vlkdntgqqfjusm.com^$third-party
-||vllwccvw.com^$third-party
-||vlpufjkwpmjhbn.com^$third-party
-||vltjkelvgvj.com^$third-party
-||vlwdjmvhf.com^$third-party
-||vlyqzdsucomih.com^$third-party
-||vlyuopulvewg.com^$third-party
-||vmftwflt.com^$third-party
-||vmmphpamtigpbi.com^$third-party
-||vmrsmnrvzh.com^$third-party
-||vmtwnkpskok.com^$third-party
-||vmyvsltb.com^$third-party
-||vndfakned.com^$third-party
-||vndrcewnard.com^$third-party
-||vnfdwoljzoaer.com^$third-party
-||vntcxqxuqki.com^$third-party
-||voaalhaobdl.com^$third-party
-||vodbordnhhemq.com^$third-party
-||voxnrvzwy.com^$third-party
-||vplvywqxsm.com^$third-party
-||vpndcpxavg.com^$third-party
-||vppabbakjzxmz.com^$third-party
-||vptkyunlzfy.com^$third-party
-||vqaizaukh.com^$third-party
-||vqkkbbivznoso.com^$third-party
-||vqmcyhsi.com^$third-party
-||vqnruxpecsn.com^$third-party
-||vqqvpouifhv.com^$third-party
-||vqzqkhumdad.com^$third-party
-||vrvyearwxo.com^$third-party
-||vrzparvhipmo.com^$third-party
-||vsgvivozec.com^$third-party
-||vsmqqjwwnoshrj.com^$third-party
-||vsrpztnxdejo.com^$third-party
-||vsrsviytlb.com^$third-party
-||vsstaewjpqcymx.com^$third-party
-||vsupeokq.com^$third-party
-||vsxjjmyz.com^$third-party
-||vtbyvtmabpclx.com^$third-party
-||vtcxhnri.com^$third-party
-||vtgdjgtwl.com^$third-party
-||vtmkgqcvzvlsdt.com^$third-party
-||vuaardbsbcppb.com^$third-party
-||vudbfsnvyzxo.com^$third-party
-||vuikvvkcdas.com^$third-party
-||vuvcwrxn.com^$third-party
-||vuwojxgklca.com^$third-party
-||vvjlrhuzmhzlws.com^$third-party
-||vvkvlqubnge.com^$third-party
-||vvqpavyfkr.com^$third-party
-||vvrygjuozwps.com^$third-party
-||vvvnbqnhxgs.com^$third-party
-||vwdjipcvcph.com^$third-party
-||vwdrpxmgehqknz.com^$third-party
-||vwfvnfvelrvvww.com^$third-party
-||vwkyuawm.com^$third-party
-||vwpoxvufxnon.com^$third-party
-||vwvnounnfteusv.com^$third-party
-||vwxptkkqbyppe.com^$third-party
-||vxijqpsxpdlztm.com^$third-party
-||vxkupxpf.com^$third-party
-||vxneczkffmaxkf.com^$third-party
-||vxrpmslex.com^$third-party
-||vxyqsxeo.com^$third-party
-||vxzudzbjvtegu.com^$third-party
-||vyagpffxvs.com^$third-party
-||vyjwsifvybc.com^$third-party
-||vzhlsmmboaqxlv.com^$third-party
-||vzlyapss.com^$third-party
-||wanrtqneiissrb.com^$third-party
-||wawlfosfkdy.com^$third-party
-||wawyxzfkab.com^$third-party
-||wbfwyzatvqjbnf.com^$third-party
-||wblkmmxi.com^$third-party
-||wbshrysmjwfplk.com^$third-party
-||wbswxksctrvw.com^$third-party
-||wbthdphsb.com^$third-party
-||wcobqyeqpckkzh.com^$third-party
-||wcwzzauws.com^$third-party
-||wcyqoiyohhav.com^$third-party
-||wdjbxcdriyjoeu.com^$third-party
-||wdkbcvnh.com^$third-party
-||wduygininqbu.com^$third-party
-||wdwczzyhzra.com^$third-party
-||wdzeuxkfvyv.com^$third-party
-||wedwcmjo.com^$third-party
-||weepjoejkqadi.com^$third-party
-||wepyyttx.com^$third-party
-||weqfcudxrrbwn.com^$third-party
-||wetunfdnruy.com^$third-party
-||wfjdmkjetpbgv.com^$third-party
-||wftduglf.com^$third-party
-||wfzpkmduyvx.com^$third-party
-||wfzvjbdicihe.com^$third-party
-||wgaycnmfz.com^$third-party
-||wglbucuhxxxj.com^$third-party
-||wgrbdqucfoieha.com^$third-party
-||wgssxjoac.com^$third-party
-||whgvyswets.com^$third-party
-||whjibbprhng.com^$third-party
-||whjwcghg.com^$third-party
-||whlugpfcuvryx.com^$third-party
-||whlvjuprdpkg.com^$third-party
-||whzavlaamjcnt.com^$third-party
-||wiazkkjbeqr.com^$third-party
-||widpzvyx.com^$third-party
-||wiezvhxoqhnn.com^$third-party
-||wiklrrrwqqf.com^$third-party
-||wiklweefcuorh.com^$third-party
-||wiywlvkwwwrms.com^$third-party
-||wjavelurhgx.com^$third-party
-||wjevvjxwg.com^$third-party
-||wjgddzpvx.com^$third-party
-||wjmckfsdcxpj.com^$third-party
-||wjpdgueqasdgeq.com^$third-party
-||wjuowevxibmg.com^$third-party
-||wjvwxcnavjodj.com^$third-party
-||wjwontqlqchq.com^$third-party
-||wkhkffefck.com^$third-party
-||wkwakmsttsehi.com^$third-party
-||wlezfkwtv.com^$third-party
-||wlhbgwzgep.com^$third-party
-||wlhgopaqpmwah.com^$third-party
-||wlszodcfwqk.com^$third-party
-||wlvjwquv.com^$third-party
-||wmqdgaptep.com^$third-party
-||wmrlljpj.com^$third-party
-||wmtyrdrpjbhnj.com^$third-party
-||wnmtmdlvqqscs.com^$third-party
-||wnstpoiqrv.com^$third-party
-||wnuvhicameqiso.com^$third-party
-||wnxyusrvcoosqi.com^$third-party
-||wnzmauurgol.com^$third-party
-||woghqyjpiwddme.com^$third-party
-||wolqstldvfkuhp.com^$third-party
-||wozltvfxtntaqk.com^$third-party
-||wpbhnyjej.com^$third-party
-||wpkcfajkeytrro.com^$third-party
-||wplqgfpj.com^$third-party
-||wpxowkmaeyrte.com^$third-party
-||wqkpadciw.com^$third-party
-||wqnpcflbcv.com^$third-party
-||wqobjrevtkqym.com^$third-party
-||wqpyqirgzfqsc.com^$third-party
-||wqtsvqzthaoq.com^$third-party
-||wqypgiakfbxb.com^$third-party
-||wrrytjtsyhrnfg.com^$third-party
-||wrwwvymy.com^$third-party
-||wssejwluqthda.com^$third-party
-||wstvcgfkvc.com^$third-party
-||wsucuzkmnd.com^$third-party
-||wszpjhuosjeexj.com^$third-party
-||wtrzjadunrzx.com^$third-party
-||wuaefxberbqcv.com^$third-party
-||wubdkryfkr.com^$third-party
-||wucbuvitibyiy.com^$third-party
-||wuldvrdfie.com^$third-party
-||wurgaxfamfgyo.com^$third-party
-||wusxwgotv.com^$third-party
-||wuuyczqcgm.com^$third-party
-||wuyednuhrxvsr.com^$third-party
-||wvetuwwcojfgw.com^$third-party
-||wvrmnqgmemkw.com^$third-party
-||wvrntfonizbxn.com^$third-party
-||wvvftburvtyz.com^$third-party
-||wwmcuhvqaf.com^$third-party
-||wwngdgldlsv.com^$third-party
-||wwnuowyww.com^$third-party
-||wwohikwhl.com^$third-party
-||wwwmurgd.com^$third-party
-||wxhpszslw.com^$third-party
-||wxmpekoil.com^$third-party
-||wxtrzeizpnp.com^$third-party
-||wybfcxze.com^$third-party
-||wyhcocqu.com^$third-party
-||wyjdunwcqnetus.com^$third-party
-||wykskkpplgfi.com^$third-party
-||wyuakcwxmiunqj.com^$third-party
-||wyycgfyum.com^$third-party
-||wyyrjymqewhulr.com^$third-party
-||wzdrtzvp.com^$third-party
-||wzghuwvuyxknpv.com^$third-party
-||wzismevwhqixlq.com^$third-party
-||wzlcpagvidi.com^$third-party
-||wznnfwhwwjkp.com^$third-party
-||wznupnxp.com^$third-party
-||xafkdsxnwinmj.com^$third-party
-||xairgknb.com^$third-party
-||xalttgptij.com^$third-party
-||xamxwvtsxdva.com^$third-party
-||xasuekjguyub.com^$third-party
-||xaxggjsa.com^$third-party
-||xblcqncce.com^$third-party
-||xbtpmwjwsjn.com^$third-party
-||xbzakxofyhdy.com^$third-party
-||xcajbqjdcguybf.com^$third-party
-||xcgebfplttrdg.com^$third-party
-||xcjelwzs.com^$third-party
-||xctiblmetgwr.com^$third-party
-||xcwnwrgvwg.com^$third-party
-||xcwqzbcpberyp.com^$third-party
-||xcyptaqhl.com^$third-party
-||xddydaddexkjxs.com^$third-party
-||xdjefibopixf.com^$third-party
-||xdlmsvhhsvsp.com^$third-party
-||xdonzpjglqxi.com^$third-party
-||xdqjeggqm.com^$third-party
-||xdsydkgkbvwq.com^$third-party
-||xdxzfqxudc.com^$third-party
-||xedybxtqd.com^$third-party
-||xeflnvycs.com^$third-party
-||xeirmdgphdl.com^$third-party
-||xellvrgouivty.com^$third-party
-||xffljxbbpy.com^$third-party
-||xfmjleuaqgnuvv.com^$third-party
-||xfrusgbifkba.com^$third-party
-||xfwwhapm.com^$third-party
-||xfwwyoxut.com^$third-party
-||xghretunapafes.com^$third-party
-||xgmlmmulciz.com^$third-party
-||xgpiuhyxbevjgs.com^$third-party
-||xgwslgpad.com^$third-party
-||xgznkebnjme.com^$third-party
-||xhfosyfia.com^$third-party
-||xhhfpakexs.com^$third-party
-||xhlrlyygx.com^$third-party
-||xhstxnpemardz.com^$third-party
-||xhyjlfbqnbr.com^$third-party
-||xibnqcksoax.com^$third-party
-||xihkdzijh.com^$third-party
-||xijgqrrhyfa.com^$third-party
-||xilnalycptredw.com^$third-party
-||xiodoyvbauv.com^$third-party
-||xiqlaxjbzjei.com^$third-party
-||xirlmiyihvpi.com^$third-party
-||xjdriaiyy.com^$third-party
-||xjjfgxdfpr.com^$third-party
-||xjtiqdylurgima.com^$third-party
-||xkcidzutjwukj.com^$third-party
-||xkgbbiqqekja.com^$third-party
-||xkhxejeaarq.com^$third-party
-||xkjlcqbufdlwrq.com^$third-party
-||xklrckmslshvq.com^$third-party
-||xkzzkxntmryst.com^$third-party
-||xlldzsgt.com^$third-party
-||xlnwabndmqn.com^$third-party
-||xlqkpyimdep.com^$third-party
-||xlspkqpnnqj.com^$third-party
-||xmazvzvbqli.com^$third-party
-||xmevsiig.com^$third-party
-||xmgrjuqqc.com^$third-party
-||xmlqerwrehfqo.com^$third-party
-||xmrchaqjwqyvz.com^$third-party
-||xmufoqjx.com^$third-party
-||xndskrtxkiv.com^$third-party
-||xnfwhndl.com^$third-party
-||xnjsdpohkgn.com^$third-party
-||xnmwxndqhyt.com^$third-party
-||xnnbvckd.com^$third-party
-||xnqfpnszqwpijd.com^$third-party
-||xnwqhydt.com^$third-party
-||xocecytufu.com^$third-party
-||xoqkhbtpnzblh.com^$third-party
-||xpbjjdrcwuqkks.com^$third-party
-||xpgcrmxejlgig.com^$third-party
-||xprurfeoarxz.com^$third-party
-||xpywzbxjwbxafv.com^$third-party
-||xqkqkfszveqvm.com^$third-party
-||xqtymopje.com^$third-party
-||xrkfqpbubaq.com^$third-party
-||xrluvlmyuxqjme.com^$third-party
-||xrmrpcbaukli.com^$third-party
-||xroonucyaoqljf.com^$third-party
-||xrpcbukuwdvkc.com^$third-party
-||xruuohzpxmmw.com^$third-party
-||xsgacudwlysw.com^$third-party
-||xsgcobwd.com^$third-party
-||xskbsyssik.com^$third-party
-||xsqylzml.com^$third-party
-||xtccyvimdr.com^$third-party
-||xtixyzjeibh.com^$third-party
-||xtsnbxwak.com^$third-party
-||xudfxpvm.com^$third-party
-||xuqdbqkqgj.com^$third-party
-||xurrehqawu.com^$third-party
-||xvapnjwhofiv.com^$third-party
-||xvgfmbrifa.com^$third-party
-||xvijskugh.com^$third-party
-||xvxcpdcnfgte.com^$third-party
-||xwavfvpzg.com^$third-party
-||xwcqrzkle.com^$third-party
-||xwdlgzrnuyo.com^$third-party
-||xwonghmweu.com^$third-party
-||xwrmlohlri.com^$third-party
-||xwvofxgqilhy.com^$third-party
-||xwxbiywlavgpm.com^$third-party
-||xxdjmuekj.com^$third-party
-||xxhgzzinkrbbo.com^$third-party
-||xxqriuedmqzs.com^$third-party
-||xyepsjnt.com^$third-party
-||xymtglljft.com^$third-party
-||xzcdzfkwk.com^$third-party
-||xzfswipynyuj.com^$third-party
-||xzwynraczfcq.com^$third-party
-||xzywlbgldmpi.com^$third-party
-||yaaqsdteo.com^$third-party
-||yahbdmyvvmjh.com^$third-party
-||yaikleyabl.com^$third-party
-||yaxbqjjemnvben.com^$third-party
-||ybbqkfzmj.com^$third-party
-||ybhgzvkqtocedj.com^$third-party
-||yblileapbnc.com^$third-party
-||ybqqjrjf.com^$third-party
-||yckdywmihuabu.com^$third-party
-||ycuuzufqwsk.com^$third-party
-||ycyrgutjregkw.com^$third-party
-||yczdebjfskegsd.com^$third-party
-||ydaynvgmkjxvy.com^$third-party
-||ydfntydegmdbk.com^$third-party
-||ydkhkjmefxy.com^$third-party
-||ydoksieuml.com^$third-party
-||ydolseawnutnf.com^$third-party
-||ydutvhtw.com^$third-party
-||ydwjfuhuiesrhp.com^$third-party
-||yeagdfyw.com^$third-party
-||yecxfxsbkb.com^$third-party
-||yefttzzn.com^$third-party
-||yennwmfmbnfz.com^$third-party
-||yeouakimhubraf.com^$third-party
-||yeuotdalcxqwr.com^$third-party
-||yfdrpdjbxjm.com^$third-party
-||yfgrucsngqitc.com^$third-party
-||yfiycpeebse.com^$third-party
-||yflyluiqdig.com^$third-party
-||yfsbprwln.com^$third-party
-||ygdnflmhslwi.com^$third-party
-||ygefxaurh.com^$third-party
-||ygemknajajg.com^$third-party
-||ygngaqihz.com^$third-party
-||yhaztdufgmw.com^$third-party
-||yhyxopmgofz.com^$third-party
-||yifuqtge.com^$third-party
-||yimfcnxzyqhpih.com^$third-party
-||yintkfbxaopyb.com^$third-party
-||yiqyefznxc.com^$third-party
-||yisscbyq.com^$third-party
-||yjctwdeuz.com^$third-party
-||yjdbnkgonfp.com^$third-party
-||yjijmpezje.com^$third-party
-||yjipohjtdrxncg.com^$third-party
-||yjseeodbma.com^$third-party
-||yjwtxskmswcjc.com^$third-party
-||yjwymbwcjyfed.com^$third-party
-||yjxtuwpbgzwc.com^$third-party
-||ykixjehac.com^$third-party
-||ykombouoo.com^$third-party
-||ykyryixcwn.com^$third-party
-||ylbslipwhfdwr.com^$third-party
-||yleztmobykox.com^$third-party
-||yljtytqq.com^$third-party
-||yllfdnftjo.com^$third-party
-||ylnmzwwc.com^$third-party
-||yloidlvfhpkq.com^$third-party
-||ymgjtzciu.com^$third-party
-||ymhqeelitngcr.com^$third-party
-||ympkaxpaf.com^$third-party
-||ymvkirvjqgha.com^$third-party
-||ymzrrizntbhde.com^$third-party
-||ynhetcoypgnl.com^$third-party
-||ynhonjqahrh.com^$third-party
-||ynkakgknfljv.com^$third-party
-||ynkbueizwqu.com^$third-party
-||ynlvwynnsstalh.com^$third-party
-||ynoiezey.com^$third-party
-||ynopkisq.com^$third-party
-||yntwcepykkts.com^$third-party
-||ynuyzeqtswtd.com^$third-party
-||ynzdtoawstxvh.com^$third-party
-||yodyfofkb.com^$third-party
-||yofyzgkoktwlc.com^$third-party
-||yoxrhwtvyqt.com^$third-party
-||ypictqesjuib.com^$third-party
-||ypixrvxi.com^$third-party
-||ypnespepnln.com^$third-party
-||yprnopqzs.com^$third-party
-||yptwqjdgikmcqc.com^$third-party
-||ypummbggdjex.com^$third-party
-||yqmmjmjxdigdak.com^$third-party
-||yrbjfusd.com^$third-party
-||yrcpupgqtn.com^$third-party
-||yrkozodemantj.com^$third-party
-||yrpjklwly.com^$third-party
-||yrtyflmurngv.com^$third-party
-||yruwnpnam.com^$third-party
-||ysaloykchjyxg.com^$third-party
-||ysljgoytuyfbg.com^$third-party
-||ysmbdnavqsbcl.com^$third-party
-||ysosfhyrbyre.com^$third-party
-||ytdoajoj.com^$third-party
-||ytjocvggodnfbn.com^$third-party
-||yttvnnvklf.com^$third-party
-||yuanaayutyd.com^$third-party
-||yuazwfzvdzfc.com^$third-party
-||yuehosgcoq.com^$third-party
-||yuimtqtp.com^$third-party
-||yurttitxfyfh.com^$third-party
-||yvbrgzeu.com^$third-party
-||yvisvreih.com^$third-party
-||yvlhxqxw.com^$third-party
-||yvlmcehqt.com^$third-party
-||yvlrhnzid.com^$third-party
-||yvsymvjzk.com^$third-party
-||yvyfyuacwz.com^$third-party
-||yvystpvmpnz.com^$third-party
-||ywcxuagtmrawx.com^$third-party
-||ywegbjiv.com^$third-party
-||ywlaafzvnn.com^$third-party
-||ywolsukpto.com^$third-party
-||ywuyrhkaiat.com^$third-party
-||ywxnjrkkrnyzc.com^$third-party
-||yxbglezas.com^$third-party
-||yxfkdvkh.com^$third-party
-||yxsyvsqrkbdqym.com^$third-party
-||yyupkqqokrus.com^$third-party
-||yyxntcpxxvtpuk.com^$third-party
-||yyyghfmjkz.com^$third-party
-||yzesxnzfhyy.com^$third-party
-||yzoyfmwr.com^$third-party
-||yzveuheeothp.com^$third-party
-||yzxibuepaiyru.com^$third-party
-||yzyalgnxo.com^$third-party
-||yzysnbqc.com^$third-party
-||zaattuotjbkj.com^$third-party
-||zabpkrvgswdroz.com^$third-party
-||zadhrsvmawp.com^$third-party
-||zajawwgpl.com^$third-party
-||zatrlsov.com^$third-party
-||zavlamhx.com^$third-party
-||zbbqhdnef.com^$third-party
-||zbsqhxyjlh.com^$third-party
-||zbvrqrjecs.com^$third-party
-||zcauvwmfevhox.com^$third-party
-||zccebnzdujjw.com^$third-party
-||zcchnqgq.com^$third-party
-||zcczlrtbbx.com^$third-party
-||zcfbwlgydxo.com^$third-party
-||zcjxeitlmnuq.com^$third-party
-||zcwjasfrog.com^$third-party
-||zdhnepeadrwetg.com^$third-party
-||zdjkzqwpqvwcmc.com^$third-party
-||zdydvjzexmp.com^$third-party
-||zeokfeyraxls.com^$third-party
-||zfcjtxosje.com^$third-party
-||zfoeiywwiqo.com^$third-party
-||zfpsotrgboqp.com^$third-party
-||zfvrrodxfb.com^$third-party
-||zggnhhadif.com^$third-party
-||zgwuvfye.com^$third-party
-||zhlfogiy.com^$third-party
-||zhpdtoott.com^$third-party
-||zhrmtsxcdkjj.com^$third-party
-||zidqkapwgnsh.com^$third-party
-||ziqdunppuzjd.com^$third-party
-||zisbrygtluib.com^$third-party
-||zjhnmbfqylme.com^$third-party
-||zjkdrqtjowihn.com^$third-party
-||zjncvhnkh.com^$third-party
-||zjnmgmidmx.com^$third-party
-||zjsbdjkdtjzoxh.com^$third-party
-||zjsbeont.com^$third-party
-||zjsnrqxltqk.com^$third-party
-||zjujxffup.com^$third-party
-||zjwcddahpz.com^$third-party
-||zkfhdpogauqb.com^$third-party
-||zkfjgzonjvg.com^$third-party
-||zkmyaizgc.com^$third-party
-||zkowrpcb.com^$third-party
-||zkqpoamv.com^$third-party
-||zksdztizohcfy.com^$third-party
-||zlahmbwm.com^$third-party
-||zlegojgwg.com^$third-party
-||zlgokeby.com^$third-party
-||zlxfpawyyoq.com^$third-party
-||zmkihizd.com^$third-party
-||zmkkiqghh.com^$third-party
-||zmogtyau.com^$third-party
-||zmujsnyzujuy.com^$third-party
-||znbokxhkwx.com^$third-party
-||znckkjdguw.com^$third-party
-||znjwkwha.com^$third-party
-||znmdscnynybx.com^$third-party
-||znnabrxnotlm.com^$third-party
-||znoumvve.com^$third-party
-||znztvqgtaivf.com^$third-party
-||zomsfhgj.com^$third-party
-||zonhpljclov.com^$third-party
-||zoszujvvlu.com^$third-party
-||zotjktpk.com^$third-party
-||zoyxbjmmlsrc.com^$third-party
-||zpaimilpqx.com^$third-party
-||zpcxpdpqllyrb.com^$third-party
-||zperfcaskqrxug.com^$third-party
-||zpghmretcikhzs.com^$third-party
-||zpkshggvjif.com^$third-party
-||zplvjgpxvh.com^$third-party
-||zpolivtjrhjquo.com^$third-party
-||zppkpktskuf.com^$third-party
-||zpwqnicvzi.com^$third-party
-||zpwtylxpfeje.com^$third-party
-||zpxgdlqoofx.com^$third-party
-||zpxlmtujszhixe.com^$third-party
-||zqdvdygz.com^$third-party
-||zqeskyeg.com^$third-party
-||zqqyhcqf.com^$third-party
-||zqswmyzlkcvrtu.com^$third-party
-||zramisxvxmkf.com^$third-party
-||zrcaldozggijht.com^$third-party
-||zreqmcewq.com^$third-party
-||zrosbqwecw.com^$third-party
-||zsikmzoehqw.com^$third-party
-||ztiqalyrbfsnl.com^$third-party
-||ztslmijniaoqip.com^$third-party
-||ztxohhagymj.com^$third-party
-||zudlddyzgogsh.com^$third-party
-||zuiiyzgiof.com^$third-party
-||zukbmxbrv.com^$third-party
-||zukipoayrlh.com^$third-party
-||zuwuqxstogbj.com^$third-party
-||zuybvpprdoo.com^$third-party
-||zvdacnjhetcrq.com^$third-party
-||zvovdtomwa.com^$third-party
-||zweigciinmslan.com^$third-party
-||zwfvzxmc.com^$third-party
-||zwpaujzg.com^$third-party
-||zwsyqdnhnyzckt.com^$third-party
-||zxaoudwcljrtig.com^$third-party
-||zxbzuyuifdqj.com^$third-party
-||zxczritytzsjz.com^$third-party
-||zxdgmcgpp.com^$third-party
-||zxeyqwgwsfv.com^$third-party
-||zxiikxeagmferu.com^$third-party
-||zxkrdvrijsp.com^$third-party
-||zxlchzyluskvj.com^$third-party
-||zxpevjccjb.com^$third-party
-||zxqudunt.com^$third-party
-||zxreyuxvrjzxa.com^$third-party
-||zxwnolwaump.com^$third-party
-||zzmyypjedpfxck.com^$third-party
-||zzomiuob.com^$third-party
-||zzoxzkpqmklr.com^$third-party
-||zzrdvzryaiwsin.com^$third-party
-||zzwajufm.com^$third-party
-||zzxosget.com^$third-party
-! WARNING: Sites listed below can be harmful. Please, do not visit them if you don't know what you're doing!
-||wjgddzpvx.com^$third-party
-! WARNING: Sites listed below can be harmful. Please, do not visit them if you don't know what you're doing!
-! 
-.bid^$script,third-party
-||aacgeuvaoqbw.com^$third-party
-||aadbobwqgmzi.com^$third-party
-||aaeqlxdgx.bid^$third-party
-||aahfcroigwso.com^$third-party
-||aajychvi.bid^$third-party
-||aanvxbvkdxph.com^$third-party
-||aaomstbnbiqo.com^$third-party
-||aapxtnrhq.bid^$third-party
-||aaqpajztftqw.com^$third-party
-||aariczayhpo.com^$third-party
-||aaslmqzce.bid^$third-party
-||aasopqgmzywa.com^$third-party
-||aatfnptblbxpuy.bid^$third-party
-||aatmytrykqhi.com^$third-party
-||aazwugtom.com^$third-party
-||abaujsqnndg.bid^$third-party
-||abbowtxibib.com^$third-party
-||abekjzzhfbr.com^$third-party
-||abunmrqsbfn.bid^$third-party
-||abuuvohpzlcrp.bid^$third-party
-||abxlmhllf.com^$third-party
-||abyvhqmfnvih.com^$third-party
-||acjmkenepeyn.com^$third-party
-||aclsqdpgeaik.com^$third-party
-||acnsavlosahs.com^$third-party
-||acpxgmzozlxtbj.bid^$third-party
-||acwswfbyhtsf.com^$third-party
-||acxujxzdluum.com^$third-party
-||adfpkxvaqeyj.com^$third-party
-||adgsfoxoavmc.com^$third-party
-||admlqqewbede.com^$third-party
-||adofuokjj.bid^$third-party
-||adrtgbebgd.bid^$third-party
-||adtbomthnsyz.com^$third-party
-||adtikimdtfbb.com^$third-party
-||adudzlhdjgof.com^$third-party
-||aduobooydxr.com^$third-party
-||aeezeynmam.bid^$third-party
-||aefqdgklyu.com^$third-party
-||aekduylxcmlevs.bid^$third-party
-||aemhabst.bid^$third-party
-||aenrqpnfmdogf.com^$third-party
-||aepwqsajypyti.com^$third-party
-||aerkxydrptnv.com^$third-party
-||aerqvywe.com^$third-party
-||aeuiazspafmbu.com^$third-party
-||aeunorkjuqtn.com^$third-party
-||aeyjbtwdf.bid^$third-party
-||aezeluusbdajjx.com^$third-party
-||afbfoxmwzlqa.com^$third-party
-||afdyfxfrwbfy.com^$third-party
-||afedispdljgb.com^$third-party
-||aflcdijgmr.bid^$third-party
-||afpisdddjik.bid^$third-party
-||afqvtomlqjioeo.com^$third-party
-||afqwfxkjmgwv.com^$third-party
-||afyqzjxzuupmz.bid^$third-party
-||agegefpkbll.bid^$third-party
-||agffpcpi.bid^$third-party
-||agfwzptrqb.bid^$third-party
-||aggntknflhal.com^$third-party
-||agiuvdbcxdirh.com^$third-party
-||agiuzlmavpnlb.com^$third-party
-||aglyzutlhnbtgu.bid^$third-party
-||agnznxaqd.com^$third-party
-||agospkfp.bid^$third-party
-||agpnzrmptmos.com^$third-party
-||agshzkcsvoou.bid^$third-party
-||agwsneccrbda.com^$third-party
-||agzupwcefbjol.bid^$third-party
-||ahfmyeuwlhp.bid^$third-party
-||ahjljmxfxuet.com^$third-party
-||ahkilcrublxn.bid^$third-party
-||ahkpdnrtjwat.com^$third-party
-||ahstrelgnh.com^$third-party
-||ahvnvtxbk.bid^$third-party
-||ahwjxktemuyz.com^$third-party
-||ahyuzjgukqyd.com^$third-party
-||ahzybvwdwrhi.com^$third-party
-||aicrgbnswhc.bid^$third-party
-||aigysycrmuoetk.com^$third-party
-||aiiaqehoqgrj.com^$third-party
-||aionvpexcmm.com^$third-party
-||aioxvilwpg.bid^$third-party
-||aiprvqqnhm.com^$third-party
-||airfhtyo.bid^$third-party
-||aiypulgy.com^$third-party
-||ajaeihzlcwvn.com^$third-party
-||ajfziqehnwvz.com^$third-party
-||ajgffcat.com^$third-party
-||ajkjnofeqrra.bid^$third-party
-||ajmggjgrardn.com^$third-party
-||ajmyrtdiwvg.bid^$third-party
-||ajocbplhzcvr.bid^$third-party
-||ajrwmjdbey.com^$third-party
-||ajuegtbkqnh.com^$third-party
-||ajxftwwmlinv.com^$third-party
-||ajxwyowuylhos.bid^$third-party
-||ajzxdeslpbnhp.bid^$third-party
-||akbiokbinnzh.com^$third-party
-||akgustnmy.com^$third-party
-||aknrvuahd.bid^$third-party
-||akoeurmzrqjg.com^$third-party
-||akovcxrklaq.bid^$third-party
-||akrzgxzjynpi.com^$third-party
-||akviqfqbwqqj.com^$third-party
-||akvtmvoolwlm.bid^$third-party
-||akxsrsdbursfpx.bid^$third-party
-||akzqosxbzl.bid^$third-party
-||aladbvddjsxf.com^$third-party
-||alajwtqyw.com^$third-party
-||alasdzdnfvtj.com^$third-party
-||aldaobpuhvl.com^$third-party
-||algkebjdgafa.com^$third-party
-||algnnojsdr.com^$third-party
-||alidnquxirv.bid^$third-party
-||alnisdrmhs.bid^$third-party
-||alvivigqrogq.com^$third-party
-||alxetzfhlzekv.bid^$third-party
-||alxzes.com^$third-party
-||amaqcgrrmedi.bid^$third-party
-||ambqphwf.com^$third-party
-||amdhlyqfy.bid^$third-party
-||amgkkjgjktml.com^$third-party
-||amhpbhyxfgvd.com^$third-party
-||amjbzzicysu.bid^$third-party
-||amlyrket.bid^$third-party
-||ammqwpksb.bid^$third-party
-||ammuburyqlhsjx.bid^$third-party
-||amnpmitevuxx.com^$third-party
-||amnrbviujof.com^$third-party
-||ampnkoudpnd.bid^$third-party
-||amqcdbles.com^$third-party
-||amqtbshegbqg.com^$third-party
-||amwupsihqfewgr.com^$third-party
-||anasjdzutdmv.com^$third-party
-||anfjrxbxbar.bid^$third-party
-||angtqemchz.bid^$third-party
-||anjjyewywjw.bid^$third-party
-||ankbmqtt.com^$third-party
-||ankcnflupb.com^$third-party
-||anleqthwxxns.com^$third-party
-||anluecyopslm.com^$third-party
-||anogjkubvdfe.com^$third-party
-||anoufpjmkled.com^$third-party
-||anqnimezkdjm.com^$third-party
-||antrtrtyzkhw.com^$third-party
-||anvagsqctxsaz.bid^$third-party
-||anvskelwpvvmtg.bid^$third-party
-||anypbbervqig.com^$third-party
-||anyuwksovtwv.com^$third-party
-||aodqhrwbaky.com^$third-party
-||aofxqchnbtae.bid^$third-party
-||aohonqhbhuljz.com^$third-party
-||aominpzhzhwj.com^$third-party
-||aomvdhxvblfp.com^$third-party
-||aoqpvhstmc.bid^$third-party
-||aoqviogrwckf.com^$third-party
-||aoqvovzrtlpn.bid^$third-party
-||aotrcqegtfhlaw.bid^$third-party
-||aoxkyvcmgr.bid^$third-party
-||aoxntgxf.bid^$third-party
-||aoyfhtarolgemn.bid^$third-party
-||apbwldhfuvnk.com^$third-party
-||apfbtiqdly.bid^$third-party
-||apgjczhgjrka.com^$third-party
-||aphjbgth.com^$third-party
-||apmgzzaej.bid^$third-party
-||apmkcdsnv.bid^$third-party
-||aprddnfuzc.bid^$third-party
-||aptaeabkg.com^$third-party
-||apuorlaqiscu.bid^$third-party
-||apwtlkkd.bid^$third-party
-||apzbwicuuujw.bid^$third-party
-||apzzvvztziqex.bid^$third-party
-||aqdrzqsuxxvd.com^$third-party
-||aqeukceruxzd.com^$third-party
-||aqjdigkqvmakz.com^$third-party
-||aqkujuggztyn.bid^$third-party
-||aqlvpnfxrkyf.com^$third-party
-||aqocbcnfxkuw.com^$third-party
-||aqodwthjaq.com^$third-party
-||aqornnfwxmua.com^$third-party
-||aqryyhyzjveh.com^$third-party
-||aqsijnkyauxur.bid^$third-party
-||aqsuhqqgv.bid^$third-party
-||aqtnrnuhqfaf.bid^$third-party
-||aqyhsqhggq.com^$third-party
-||aragvjeosjdx.com^$third-party
-||arawegnvvufy.com^$third-party
-||arfttojxv.com^$third-party
-||arllvzkoh.com^$third-party
-||arloxpiosxzjw.bid^$third-party
-||arprijxrml.bid^$third-party
-||arqxpopcywrr.bid^$third-party
-||artnbnbam.com^$third-party
-||artucripkzu.com^$third-party
-||arxerlxllv.bid^$third-party
-||aryufuxbmwnb.com^$third-party
-||asecxggulyrf.com^$third-party
-||ashwlrtiazee.com^$third-party
-||asmvccgoy.bid^$third-party
-||asotnnwspw.bid^$third-party
-||asqamasz.com^$third-party
-||aszdmbftkccdkj.com^$third-party
-||ataufekxogxr.com^$third-party
-||atcyboopajyp.com^$third-party
-||atebqbjh.bid^$third-party
-||atijsiwpbrvtm.bid^$third-party
-||atjgtndhvbescp.bid^$third-party
-||atkkkyhyxemut.bid^$third-party
-||atryzvsn.com^$third-party
-||atzrsfweb.bid^$third-party
-||aubmolods.com^$third-party
-||aubrythgmge.bid^$third-party
-||aueceijyp.bid^$third-party
-||aufyuiavvkf.bid^$third-party
-||autkmgrbdlbj.com^$third-party
-||avbnzstidjh.com^$third-party
-||avdfcctzwfdk.com^$third-party
-||avditmiohvtq.bid^$third-party
-||avefyjulko.bid^$third-party
-||avfymwmwpky.com^$third-party
-||avlysyhuvxebl.bid^$third-party
-||avokvnpqunol.bid^$third-party
-||avptczdpdh.bid^$third-party
-||avrdpbiwvwyt.com^$third-party
-||avvfgiytnir.com^$third-party
-||avvlnbpwpemfl.bid^$third-party
-||avzkjvbaxgqk.com^$third-party
-||awaeswvqd.bid^$third-party
-||awfjqdhcuftd.com^$third-party
-||awgdgpawhwgi.bid^$third-party
-||awgyhiupjzvu.com^$third-party
-||awjgketgdpzqxo.bid^$third-party
-||awjkbnhylulcl.bid^$third-party
-||awogbtinorwx.com^$third-party
-||awrspmpj.com^$third-party
-||awsatstb.com^$third-party
-||awvrvqxq.com^$third-party
-||awvuhwqyimgd.com^$third-party
-||awxjpkxoqfwaj.bid^$third-party
-||axaggthnkquj.com^$third-party
-||axbouiklwghehw.com^$third-party
-||axbpixbcucv.bid^$third-party
-||axbsdoysiogrrc.bid^$third-party
-||axeobgnsk.com^$third-party
-||axfihweksrgor.com^$third-party
-||axfkfstrbacx.com^$third-party
-||axglltqwtmnl.com^$third-party
-||axhkxqmrqxf.bid^$third-party
-||axjnnlrc.bid^$third-party
-||axkiznybznfa.bid^$third-party
-||axsczaklngkxx.com^$third-party
-||axzrxkkklakka.com^$third-party
-||ayhdwulehfdwn.com^$third-party
-||ayjebauqdrys.com^$third-party
-||aykosfkx.bid^$third-party
-||ayloqdal.bid^$third-party
-||ayozhcgcsyun.com^$third-party
-||ayyvsbbbav.com^$third-party
-||azbdbtsmdocl.com^$third-party
-||azditojzcdkc.com^$third-party
-||azeozrjk.com^$third-party
-||azfmulmqcz.bid^$third-party
-||azgyzdjexcxg.com^$third-party
-||azhdgruuvllzxg.com^$third-party
-||azkvcgzjsrmk.com^$third-party
-||azlbmpidrvnoi.bid^$third-party
-||azofucrzkkaa.com^$third-party
-||azqmmfhmfnpsvb.bid^$third-party
-||azroydhgqcfv.com^$third-party
-||azzvkcavtgwp.com^$third-party
-||badgmvhtvryg.bid^$third-party
-||bagoojzsqygg.com^$third-party
-||baiaclwdpztd.com^$third-party
-||bajofdblygev.com^$third-party
-||bakdsoarxjab.com^$third-party
-||bakjtxvku.bid^$third-party
-||baommitouduxo.bid^$third-party
-||batigfkcbwpb.com^$third-party
-||bauffnmtou.com^$third-party
-||bayvlsmaahou.com^$third-party
-||bbbrhcxtdkfui.bid^$third-party
-||bbheuxcancwj.com^$third-party
-||bbjlsdqhpbuqaspgjyxaobmpmzunjnvqmahejnwwvaqbzzqodu.com^$third-party
-||bbkxmpgjwo.bid^$third-party
-||bblznptpffqc.com^$third-party
-||bbmkyxvxiw.bid^$third-party
-||bboemhlddgju.com^$third-party
-||bbopkapcgonb.com^$third-party
-||bbqipbsg.bid^$third-party
-||bbqqjejhd.bid^$third-party
-||bbtlombqjr.bid^$third-party
-||bbzwbxchqgph.com^$third-party
-||bcgcvepi.com^$third-party
-||bckmtidcnrobwh.bid^$third-party
-||bckwfsvdgfjw.com^$third-party
-||bcnhnekodmdniu.com^$third-party
-||bcnikicdi.bid^$third-party
-||bcoavtimgn.bid^$third-party
-||bcxdjxlassr.bid^$third-party
-||bcxfshnxaiqemn.bid^$third-party
-||bczvulovuap.com^$third-party
-||bdafhnltyxlw.com^$third-party
-||bddaxoaaco.bid^$third-party
-||bddfeltry.bid^$third-party
-||bdggxjonzbmq.com^$third-party
-||bdkduogsu.bid^$third-party
-||bdotqoqzxauf.com^$third-party
-||bdozkocgkljj.com^$third-party
-||bdrfwkzu.bid^$third-party
-||bdyzewccsqpw.com^$third-party
-||bebufuspldzh.com^$third-party
-||bebxxrgjigz.com^$third-party
-||beeseggjfru.bid^$third-party
-||befxqicnz.bid^$third-party
-||begbkbqywd.bid^$third-party
-||beghfkrygvxp.com^$third-party
-||begxhuqfrx.bid^$third-party
-||behjgnhniasz.com^$third-party
-||behybmunweid.com^$third-party
-||bektvxxfv.bid^$third-party
-||beufosew.bid^$third-party
-||bewcmime.com^$third-party
-||bewovdhiubnk.com^$third-party
-||bewumuhax.bid^$third-party
-||bexogxapbqict.bid^$third-party
-||bezcmsrzx.com^$third-party
-||bezqvpliexxtfw.com^$third-party
-||bfcazxhkofa.club^$third-party
-||bfdihioj.com^$third-party
-||bfhavmgufvhn.com^$third-party
-||bfidvcsuazwy.com^$third-party
-||bflcuvtyffao.bid^$third-party
-||bfpzhrzcvs.bid^$third-party
-||bfsssvkowvh.com^$third-party
-||bfzuuuuhvexxs.com^$third-party
-||bgarilrzlgez.com^$third-party
-||bgbdzfeeoko.com^$third-party
-||bgbmtqzoc.bid^$third-party
-||bgcsojmtgdrv.com^$third-party
-||bgdacrgsnt.com^$third-party
-||bgfgaduyvocz.com^$third-party
-||bgibeluywjhgb.com^$third-party
-||bgitczbd.com^$third-party
-||bgpxrwjrbsjb.com^$third-party
-||bgrojtcdymmcdr.com^$third-party
-||bgtmceqoipodkv.com^$third-party
-||bguaeoakgmrw.com^$third-party
-||bgxjypaeyocjy.bid^$third-party
-||bgybufwnfxkcr.bid^$third-party
-||bhbkfoybvrl.bid^$third-party
-||bhcpmowwxwbv.com^$third-party
-||bhejerqgrtlq.com^$third-party
-||bhfpvqdmjarlk.com^$third-party
-||bhggbeynqhwm.bid^$third-party
-||bhjhijisulwl.com^$third-party
-||bhklyaazmxq.com^$third-party
-||bhmenavkijeufq.bid^$third-party
-||bhmenywkptbkga.bid^$third-party
-||bhmqoolzgxnp.com^$third-party
-||bhuewuodwz.bid^$third-party
-||bhyqllgtzjee.com^$third-party
-||bhyyevhmha.com^$third-party
-||bictxzszwkwghn.com^$third-party
-||biftbtajfs.bid^$third-party
-||bihzqdflxeelc.com^$third-party
-||bijfzvbtwhvf.com^$third-party
-||binasmdul.com^$third-party
-||bircgizd.com^$third-party
-||birpidnl.com^$third-party
-||bisvljlzmai.com^$third-party
-||biwjfwhxoy.bid^$third-party
-||bjcunwelpd.com^$third-party
-||bjdfckchzsa.bid^$third-party
-||bjenzpojtgvo.club^$third-party
-||bjfxcvebjrcuce.bid^$third-party
-||bjgavencynifm.bid^$third-party
-||bjgaxcstxlvm.bid^$third-party
-||bjjjbwexvkotj.com^$third-party
-||bjkfmvhygpub.com^$third-party
-||bjknjsfrevt.bid^$third-party
-||bjkookfanmxx.bid^$third-party
-||bjmrnfwcoqp.bid^$third-party
-||bjnxegsgre.com^$third-party
-||bjpktmjdxqpl.com^$third-party
-||bjshimgqbc.com^$third-party
-||bjswchnxfoui.bid^$third-party
-||bjvynucz.bid^$third-party
-||bjzcyqezwksznxxhscsfcogugkyiupgjhikadadgoiruasxpxo.com^$third-party
-||bjzegkfv.com^$third-party
-||bkeueifcqeicli.bid^$third-party
-||bkgesylgvrgf.com^$third-party
-||bkggsumw.bid^$third-party
-||bkmmlcbertdbselmdxpzcuyuilaolxqfhtyukmjkklxphbwsae.com^$third-party
-||bkmtspywevsk.com^$third-party
-||bkqksceiw.bid^$third-party
-||bkscqpflg.com^$third-party
-||bkshpuspj.bid^$third-party
-||bktrlzpxcft.bid^$third-party
-||bkuzcrcdh.bid^$third-party
-||bkvrdeiqtgan.bid^$third-party
-||bkxkodsmrnqd.com^$third-party
-||blcmacswwmqv.com^$third-party
-||blkivkplpn.com^$third-party
-||blnxyqdnsl.bid^$third-party
-||blorgkjhbhoqr.bid^$third-party
-||blprkaomvazv.com^$third-party
-||blrdumgvqkmq.com^$third-party
-||blvqxlczxeda.com^$third-party
-||blyppvdjofkqg.bid^$third-party
-||bmalhekpohve.bid^$third-party
-||bmayhacntxax.com^$third-party
-||bmbnpxxwxdt.com^$third-party
-||bmhvaoxr.com^$third-party
-||bmirhdkborr.bid^$third-party
-||bmjccqfxlabturkmpzzokhsahleqqrysudwpuzqjbxbqeakgnf.com^$third-party
-||bmjwsrcxvnsjne.com^$third-party
-||bmmqsdyud.com^$third-party
-||bmnccwprdrszpj.bid^$third-party
-||bmqnguru.com^$third-party
-||bmsmhlpkdvajeo.bid^$third-party
-||bmubqabepbcb.com^$third-party
-||bmvhefgdlt.bid^$third-party
-||bmxufcsmxcfwao.bid^$third-party
-||bmyepmehjzhz.com^$third-party
-||bnbotxyfewtroa.bid^$third-party
-||bnfjallm.bid^$third-party
-||bniarapemvbd.com^$third-party
-||bnkgacehxxmx.com^$third-party
-||bnnsgqjofzar.com^$third-party
-||bnqaljyjkpwmiu.bid^$third-party
-||bnqgubwpq.com^$third-party
-||bnstnhto.com^$third-party
-||bnwjoqkudmh.bid^$third-party
-||bocksnabswdq.com^$third-party
-||boevznvrllm.bid^$third-party
-||bogkmogzrvzf.com^$third-party
-||boguaokxhdsa.com^$third-party
-||boiukzfgrp.bid^$third-party
-||bolgooltxygp.com^$third-party
-||bomjrcum.bid^$third-party
-||bowqvvztlkzn.com^$third-party
-||bpblqdfe.bid^$third-party
-||bpbwwasthwtp.com^$third-party
-||bpcegfmfzvkjmi.bid^$third-party
-||bpehfety.bid^$third-party
-||bpfxtrzapdxdr.bid^$third-party
-||bpglbuxwx.com^$third-party
-||bpprksdgogtw.com^$third-party
-||bprnphojtfl.bid^$third-party
-||bqbagfhhbhyzq.bid^$third-party
-||bqdpscae.bid^$third-party
-||bqgvtryyrhjmf.com^$third-party
-||bqptlqmtroto.com^$third-party
-||bqqjowpigdnx.com^$third-party
-||bqscwtvpvugopg.com^$third-party
-||bqyphmwr.bid^$third-party
-||bqytfutmwulr.com^$third-party
 ||brhkraeknmjk.com^$third-party
 ||briqsnyafmmkxr.com^$third-party
 ||briqumvlvzshh.com^$third-party
 ||brjbzbxbcqjb.com^$third-party
 ||brjycsvgpo.bid^$third-party
+||brloygpasa.com^$third-party
 ||brmrwnopuowq.bid^$third-party
 ||brqrtgjklary.com^$third-party
 ||brrxmhuhyokw.bid^$third-party
@@ -40120,46 +37684,65 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||brwusdmjzv.bid^$third-party
 ||brycnuxoytuang.com^$third-party
 ||brygxppyaugt.com^$third-party
+||bryvvdtek.com^$third-party
 ||brzmefeoqwdakc.bid^$third-party
 ||brztxamj.com^$third-party
 ||bsaixnxcpaai.com^$third-party
 ||bsepyppitmkkf.com^$third-party
+||bsjhbxtrbvkr.com^$third-party
+||bskijhtct.com^$third-party
 ||bslgmaxqild.bid^$third-party
 ||bslqjxmltuel.bid^$third-party
+||bsmryjou.com^$third-party
 ||bsnbfufjgxrb.com^$third-party
 ||bspjagxietut.com^$third-party
+||bsqbdbtftyu.com^$third-party
 ||bsqliktzudq.bid^$third-party
+||bsrmcmvdoeyzib.com^$third-party
 ||bsupflnjmuzn.com^$third-party
 ||bsxctkajqdp.com^$third-party
 ||btbapoifsphl.com^$third-party
 ||btcwkbqojiyg.com^$third-party
+||btgovcuviqor.com^$third-party
 ||btjxbwiehrm.bid^$third-party
 ||btkaoblylg.bid^$third-party
 ||btkcdqrzmqca.com^$third-party
 ||btmcxzanpsi.com^$third-party
 ||btnbdmhxdsf.com^$third-party
+||btovopyov.com^$third-party
 ||btpgbmvlk.bid^$third-party
 ||btqwmdinav.com^$third-party
 ||btsimocheozy.bid^$third-party
+||bturlzbakbcsdd.com^$third-party
 ||btvdzlkg.bid^$third-party
 ||btwpplvcqao.com^$third-party
 ||btxoeiisonxh.com^$third-party
 ||btxyusxfbx.com^$third-party
+||btzuecidcshmmv.com^$third-party
+||buadnqirhykcyc.com^$third-party
 ||buauaamx.bid^$third-party
 ||budyxjttmjkf.com^$third-party
 ||bufqrxzyrecf.com^$third-party
+||bugwiqivdqotjk.com^$third-party
+||buhlhkkvljt.com^$third-party
 ||buhxsaifjxupaj.com^$third-party
 ||buitxcrnucyi.com^$third-party
 ||bujntrmh.com^$third-party
+||bukpsslm.com^$third-party
+||burobtnbpgkh.com^$third-party
 ||burvyzqwfqg.bid^$third-party
+||bvcddoyb.com^$third-party
 ||bvevgygeu.bid^$third-party
 ||bvezznurwekr.com^$third-party
 ||bvhzswlde.bid^$third-party
+||bvjexgnagddtmu.com^$third-party
 ||bvnekcpa.bid^$third-party
+||bvnmmdelarn.com^$third-party
 ||bvobtmbziccr.com^$third-party
 ||bvqfuryhas.bid^$third-party
 ||bvreosoejjt.bid^$third-party
 ||bvrkzhtxlgono.com^$third-party
+||bvwkethv.com^$third-party
 ||bvwzffbinbou.com^$third-party
 ||bvyoekxfjwpa.com^$third-party
 ||bvzhalhubwkbg.bid^$third-party
@@ -40170,113 +37753,194 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||bwlstzzqxpuxr.bid^$third-party
 ||bwnrgfhbd.bid^$third-party
 ||bwoefrhtycp.com^$third-party
+||bwohgwrk.com^$third-party
 ||bwpqqofejekh.com^$third-party
 ||bwssvome.com^$third-party
 ||bwuxrzvr.bid^$third-party
+||bwvigmkn.com^$third-party
+||bwwfncfuzahpg.com^$third-party
 ||bwyckpmsolzk.com^$third-party
 ||bwzohoomljs.com^$third-party
+||bxejeqyudkgum.com^$third-party
 ||bxexufifrsfr.com^$third-party
 ||bxfsdzpffy.bid^$third-party
+||bxknvtbmzsqc.com^$third-party
+||bxniyvvxufxyoy.com^$third-party
 ||bxoemfpetyqi.bid^$third-party
 ||bxoixzbtllwx.com^$third-party
 ||bxpbwitpgbid.bid^$third-party
+||bxravgxfkubm.com^$third-party
 ||bxrjiqoajbbh.com^$third-party
 ||bxtcgufurbdk.bid^$third-party
+||bxvydxjqklq.com^$third-party
 ||bxwbflhpk.com^$third-party
+||bxxhbrpxqtwfq.com^$third-party
 ||bxxlvfhaxwscz.com^$third-party
 ||bxzkknilgmdt.bid^$third-party
+||byclitror.com^$third-party
 ||bydbjtaoy.bid^$third-party
 ||byecttekgbksr.bid^$third-party
+||bygigguvflpv.com^$third-party
 ||bymyneknm.bid^$third-party
 ||byoftdngsqjezw.bid^$third-party
 ||bypjftbwbpj.bid^$third-party
 ||byqmzodcdhhu.com^$third-party
 ||byspwzspx.bid^$third-party
+||bysziktift.com^$third-party
 ||byufpbvjpedvpx.com^$third-party
 ||byuwgtzpawzzd.com^$third-party
+||byxlivaqzo.com^$third-party
 ||byxlzyvfgb.bid^$third-party
 ||bzbaizntfrhl.com^$third-party
 ||bzeidqugwde.bid^$third-party
+||bzeitvxguf.com^$third-party
 ||bzfguipyjops.com^$third-party
+||bzfvcavza.com^$third-party
 ||bzgwkxnjqjdz.com^$third-party
 ||bzjtjfjteazqzmukjwhyzsaqdtouiopcmtmgdiytfdzboxdann.com^$third-party
+||bzkmfzoxqmau.com^$third-party
 ||bzlvolaqiy.bid^$third-party
 ||bznmgijglbpr.com^$third-party
+||bzotzfcbhomw.com^$third-party
 ||bzqqaoeufrld.com^$third-party
+||bzrsybcg.com^$third-party
 ||bzsbtfiz.com^$third-party
+||bzvimexwdle.com^$third-party
 ||bzyrhqbdldds.com^$third-party
+||caajevalistl.com^$third-party
+||caaqyzbpsbtk.com^$third-party
 ||cacpcaizwx.bid^$third-party
+||cadchbpsifb.com^$third-party
 ||cadulscdfhtcb.bid^$third-party
 ||cafvzpusl.com^$third-party
 ||cahepysgenpb.com^$third-party
+||camrfajedgku.com^$third-party
+||capquqhuiazl.com^$third-party
 ||carsxardivaf.com^$third-party
+||caucqpoeg.com^$third-party
+||cavdzowr.com^$third-party
 ||cawcwpvmpcje.com^$third-party
 ||cayaaebmb.com^$third-party
+||cayqecxokz.com^$third-party
 ||cbbabemymc.com^$third-party
+||cbchvrgqb.com^$third-party
+||cbcjkmyetnqch.com^$third-party
+||cbdjzemui.com^$third-party
 ||cbehcazifywmro.bid^$third-party
+||cbgujxjlp.com^$third-party
+||cbhpiuopomc.com^$third-party
+||cbiapaofuviswf.com^$third-party
 ||cbnrvzfvmd.com^$third-party
 ||cbolsxvresvu.bid^$third-party
 ||cbrqndeptsw.com^$third-party
 ||cbsfcpciitwcky.com^$third-party
 ||cbtdjpspjp.com^$third-party
+||cbuxzegro.com^$third-party
 ||cbwrwcjdctrj.com^$third-party
 ||cbxadrwlccrky.bid^$third-party
 ||cbxqceuuwnaz.com^$third-party
 ||cbxtnudkklwh.com^$third-party
 ||cbyjjheawrcfq.com^$third-party
+||cbzkrwjdskg.com^$third-party
 ||ccabzumewfk.bid^$third-party
 ||ccaypkuiauizuh.bid^$third-party
 ||ccbaobjyprxh.com^$third-party
 ||cccytihi.bid^$third-party
 ||ccdkyvyw.com^$third-party
 ||ccefzhxgobjm.com^$third-party
+||ccemeoqbqb.com^$third-party
 ||ccmoxtwauruz.bid^$third-party
 ||ccpnzfts.com^$third-party
 ||ccscpyeeiqhs.bid^$third-party
 ||ccvewygyjqbq.bid^$third-party
 ||ccwinenmbnso.com^$third-party
+||ccyttdkwntyhx.com^$third-party
+||cczixhwxprith.com^$third-party
+||cdaywwdyicf.com^$third-party
+||cdbhmahnjb.com^$third-party
 ||cdbkxcnfmehf.com^$third-party
 ||cdbxuzzlgfhh.com^$third-party
 ||cddlngatmpthc.bid^$third-party
+||cdegnloptetj.com^$third-party
 ||cdfyuyoyfxohj.bid^$third-party
 ||cdhzxcwuibzk.com^$third-party
 ||cdicyazp.com^$third-party
+||cdkxvrryzgd.com^$third-party
+||cdmjjvqzurn.com^$third-party
 ||cdobneyuq.com^$third-party
+||cdookjqkri.com^$third-party
 ||cdqmeyhqrwinofutpcepbahedusocxqyfokvehqlqpusttfwve.com^$third-party
+||cdqweuwvagrbd.com^$third-party
 ||cdrjblrhsuxljwesjholugzxwukkerpobmonocjygnautvzjjm.com^$third-party
 ||cdtojdrhoc.bid^$third-party
 ||cdveeechegws.com^$third-party
+||cdvoqspgdp.com^$third-party
+||cdyiipzo.com^$third-party
+||cdyygbzihdh.com^$third-party
+||cdzifdzftkmfof.com^$third-party
 ||ceidxneoogpuh.com^$third-party
+||cekptlucf.com^$third-party
 ||ceseyitsikzs.com^$third-party
 ||cesxssavc.com^$third-party
 ||ceugjbwb.com^$third-party
+||cevwkduhwbuc.com^$third-party
 ||cewdbisyrzdv.com^$third-party
 ||cewegncr.com^$third-party
 ||cewviaslxyyr.com^$third-party
 ||ceywprmvjy.com^$third-party
 ||cfdmkifknsjt.com^$third-party
+||cfhkiriics.com^$third-party
+||cfkhdbzn.com^$third-party
+||cfnumapv.com^$third-party
+||cfpqhrfpccmpq.com^$third-party
+||cfqzixjwwqgow.com^$third-party
+||cfraazitu.com^$third-party
 ||cfsdtzggpcmr.com^$third-party
+||cfskcqrwbog.com^$third-party
+||cftervwhu.com^$third-party
+||cfuwbptxcdgza.com^$third-party
 ||cfvfjsobudwrsn.com^$third-party
 ||cfyvrgvopaejx.com^$third-party
 ||cfzskkkmjg.com^$third-party
+||cgaemihcbvr.com^$third-party
 ||cgbemyws.bid^$third-party
 ||cgbqzfjf.com^$third-party
 ||cgdvsvczduzq.bid^$third-party
+||cgjbizumzm.com^$third-party
 ||cgjyesqhxzzm.com^$third-party
+||cgkpwhkgjxo.com^$third-party
+||cglcdshkqiuic.com^$third-party
+||cglpmszvpzzxj.com^$third-party
+||cglqqjxaaowb.com^$third-party
 ||cgmkpdqjnedb.com^$third-party
+||cgnfyfer.com^$third-party
+||cgociipdf.com^$third-party
+||cgrvnpkwuytts.com^$third-party
+||cgtqfbnviajcx.com^$third-party
+||cguvvvdxa.com^$third-party
+||cgwhbzfxhwltpm.com^$third-party
 ||chiybszey.bid^$third-party
+||chjfbjjgqts.com^$third-party
+||chjvykulvzey.com^$third-party
 ||chlpyktpzcciyh.com^$third-party
+||chnktglh.com^$third-party
 ||chnvilhrmeaw.bid^$third-party
+||chqspuonctkgz.com^$third-party
 ||chqulqxfghdz.com^$third-party
 ||chtpcjezorlo.com^$third-party
 ||chuvzwxbpf.bid^$third-party
 ||chvjfriqlvnt.com^$third-party
+||chvwtxtzmzbggo.com^$third-party
 ||chxfeymgmwbo.com^$third-party
+||chxwlqtvgrw.com^$third-party
 ||chyfjrkstyzl.bid^$third-party
 ||chytrrvwvabg.com^$third-party
 ||chzashakbgds.com^$third-party
 ||ciaszbncdj.bid^$third-party
 ||cibmcziio.bid^$third-party
+||ciecissstwncw.com^$third-party
+||cifipkbu.com^$third-party
+||cifwsaufnalvh.com^$third-party
 ||cihnrhqwbcsq.com^$third-party
 ||cijfsxtsjpx.bid^$third-party
 ||cijwskfvye.com^$third-party
@@ -40288,17 +37952,28 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||cipohwidxc.com^$third-party
 ||cisfjtamphuqt.com^$third-party
 ||cistcrrhqfm.bid^$third-party
+||civyssfaqtufib.com^$third-party
+||ciwbezny.com^$third-party
 ||cixjiydrsyq.bid^$third-party
 ||cixjmaxkemzknxxuyvkbzlhvvgeqmzgopppvefpfkqdraonoez.com^$third-party
+||cixvlpbnceh.com^$third-party
+||cizemeshbbc.com^$third-party
 ||cjbaeegayainxl.bid^$third-party
+||cjdomdjyvble.com^$third-party
+||cjgpifztileh.com^$third-party
 ||cjhdmrcv.com^$third-party
 ||cjkjeyjbl.com^$third-party
 ||cjnoeafncyzb.com^$third-party
 ||cjnqsrzyhil.com^$third-party
 ||cjnwobsladbq.com^$third-party
+||cjojvvfyb.com^$third-party
 ||cjprndsozzdu.bid^$third-party
+||cjsgmoekcb.com^$third-party
 ||cjuntyydjokvde.com^$third-party
+||cjuztylaun.com^$third-party
 ||cjvgnswapbqo.com^$third-party
+||cjvpybdsasarc.com^$third-party
+||cjwjpmudu.com^$third-party
 ||cjxdbmxtnqmy.com^$third-party
 ||cjxkzkzmdomd.com^$third-party
 ||ckfctuaga.com^$third-party
@@ -40307,6 +37982,8 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||ckjflngcqcfl.bid^$third-party
 ||ckjjcarzu.com^$third-party
 ||ckjjnujgvfd.com^$third-party
+||ckkrlzxvy.com^$third-party
+||ckopycdb.com^$third-party
 ||ckqfackpj.bid^$third-party
 ||ckqgkazihvwc.com^$third-party
 ||ckqjezikww.bid^$third-party
@@ -40315,40 +37992,57 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||ckryzlnafwyd.com^$third-party
 ||ckwpsghi.com^$third-party
 ||ckxhoidrflu.com^$third-party
+||ckxqtppyzqbll.com^$third-party
+||ckxyvauhqfuoin.com^$third-party
 ||ckydzwjzbgarz.bid^$third-party
 ||ckyxscaeockj.bid^$third-party
 ||cledghtdrjtb.com^$third-party
+||clgyhwaoh.com^$third-party
 ||clhkbfqzwpst.com^$third-party
 ||clhqmynew.bid^$third-party
+||clkkcokl.com^$third-party
 ||clomggnzxsyf.bid^$third-party
 ||clonsvyhy.bid^$third-party
+||clouxtnxsmxdva.com^$third-party
+||clsvugmivpf.com^$third-party
+||clsyxddpbt.com^$third-party
+||clutaqawmz.com^$third-party
 ||clxakmsyjlryz.bid^$third-party
+||clybtbahdbwkep.com^$third-party
 ||clyksqxxdeduq.bid^$third-party
 ||cmdjujqlfbts.com^$third-party
 ||cmdnzbuynnm.com^$third-party
 ||cmdotgwjhpqf.com^$third-party
 ||cmhwwdwfiyx.com^$third-party
 ||cmjjzwddw.com^$third-party
+||cmncgeqivmjki.com^$third-party
+||cmnhwzdsvr.com^$third-party
 ||cmpkynhhmkni.com^$third-party
 ||cmpsuzvr.com^$third-party
 ||cmqeojydveotb.bid^$third-party
 ||cmqyhtqkhduy.com^$third-party
+||cmrppltjs.com^$third-party
 ||cmrxvyjyaerf.com^$third-party
 ||cmwsdhdyregbyn.bid^$third-party
 ||cmyjgtiihmit.bid^$third-party
 ||cmyzmrgrtyrkt.com^$third-party
 ||cnckdochd.com^$third-party
+||cncqycrckl.com^$third-party
 ||cnfiukuediuy.com^$third-party
 ||cnfuhtsefojuk.com^$third-party
 ||cnjkrbhtbv.com^$third-party
 ||cnntsmnymvnp.com^$third-party
 ||cnnzfijy.bid^$third-party
 ||cnoytvqomyhjz.com^$third-party
+||cnpntmju.com^$third-party
 ||cnqanzdb.com^$third-party
 ||cnsnoljocc.com^$third-party
+||cnutjhszkjse.com^$third-party
 ||cnuxnqgjkjqmky.bid^$third-party
 ||cnyblliqyhcs.bid^$third-party
 ||cnygzgurqpwop.bid^$third-party
+||coaincltxhw.com^$third-party
+||cofybuwuc.com^$third-party
 ||cogxsnvqesph.com^$third-party
 ||cohhcaahxxcf.com^$third-party
 ||coiphezlzpl.bid^$third-party
@@ -40357,7 +38051,9 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||collamps.com^$third-party
 ||comgnnyx.com^$third-party
 ||comwgi.com^$third-party
+||cooowbno.com^$third-party
 ||cortxphssdvc.com^$third-party
+||coshfgpgab.com^$third-party
 ||covjoecuzyss.com^$third-party
 ||cowmslkltc.com^$third-party
 ||coxgtwdios.bid^$third-party
@@ -40381,70 +38077,116 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||cqbabfsyfqse.com^$third-party
 ||cqbphspgvhuk.com^$third-party
 ||cqcebzspxptwfl.bid^$third-party
+||cqhxrlnhzlda.com^$third-party
 ||cqieqaxlphdi.com^$third-party
 ||cqindhgqi.com^$third-party
+||cqjnxsbuplcqri.com^$third-party
 ||cqoxufzgev.bid^$third-party
 ||cqoyvpldkmqt.com^$third-party
 ||cqskvtpeqcp.bid^$third-party
 ||cqsmswwidrn.bid^$third-party
 ||cqvbvpxnqqcfwl.bid^$third-party
+||cqwqxapujf.com^$third-party
+||cqyfjodshwuici.com^$third-party
 ||cqzqdoqsgxyf.com^$third-party
+||cracwrddcb.com^$third-party
+||crcewevoy.com^$third-party
 ||credbgvhijbcj.com^$third-party
 ||creyboif.bid^$third-party
+||crgfbmzsk.com^$third-party
+||crheaeqw.com^$third-party
 ||crijpgcer.com^$third-party
+||crjsrbyybipozq.com^$third-party
 ||crkgtnad.com^$third-party
 ||crkliqlyabacgt.bid^$third-party
 ||crnxueioe.bid^$third-party
 ||croxdfrdjfnt.com^$third-party
 ||crpiucewddag.com^$third-party
+||crpmohfici.com^$third-party
 ||crqnosmxstdfnp.bid^$third-party
+||crrgnnqidpf.com^$third-party
 ||crtntrvjuun.bid^$third-party
 ||cruqmpwhczna.bid^$third-party
+||crvvrxfgsvohiy.com^$third-party
+||crxhbchbd.com^$third-party
+||crykaxliilz.com^$third-party
 ||crzhxquiyo.com^$third-party
 ||crzlkluxnigce.com^$third-party
 ||crzojmwnnq.com^$third-party
 ||csbsyukodmga.com^$third-party
 ||cscactmkbfvn.com^$third-party
 ||csdqikvba.bid^$third-party
+||csdzhoku.com^$third-party
+||cshzkkihjnweb.com^$third-party
+||csionjbak.com^$third-party
+||csjayzqifekaq.com^$third-party
+||cskwckhyhriyk.com^$third-party
 ||cslxhmchzgbx.com^$third-party
 ||csmqorveetie.com^$third-party
+||csouqeeviwo.com^$third-party
+||cspyozjbwb.com^$third-party
 ||cstdfxkxbqbc.com^$third-party
+||cstfzgckbtrb.com^$third-party
 ||csxokexd.com^$third-party
 ||csyngxtkifrh.com^$third-party
+||ctcpwymaeuwnqd.com^$third-party
 ||ctfscglqjzkfe.com^$third-party
 ||ctgoivpnnze.bid^$third-party
 ||ctimfrfrmqip.com^$third-party
 ||ctjjftxn.bid^$third-party
+||ctjtlrmy.com^$third-party
 ||ctjwmzryhcoj.com^$third-party
 ||ctnbnbjcjfkf.bid^$third-party
 ||ctohqzii.com^$third-party
+||ctpjfacao.com^$third-party
 ||ctplyvuuzdcv.com^$third-party
+||ctrsopfwiadfjn.com^$third-party
+||ctsrwmcshv.com^$third-party
+||cttnlnsnwdokqb.com^$third-party
 ||ctvsgkoe.bid^$third-party
 ||ctzvtevpcssx.com^$third-party
 ||cuabgfjnib.bid^$third-party
 ||cuchpagh.com^$third-party
+||cudjntck.com^$third-party
 ||cuecxgwkjtan.com^$third-party
 ||cuguwxkasghy.com^$third-party
 ||cuhicevdjsfey.com^$third-party
+||cujsutkdbz.com^$third-party
 ||cukabtvyl.com^$third-party
+||cukwbpne.com^$third-party
 ||cupzwcxgx.com^$third-party
+||curnkiosk.com^$third-party
 ||cuvbcwgenwytrk.bid^$third-party
 ||cuxsmovh.bid^$third-party
+||cvarxvlbnphcjq.com^$third-party
+||cvdvexais.com^$third-party
+||cvembcmcvrxly.com^$third-party
 ||cvffhevoebnz.com^$third-party
+||cvhcrbbbfaa.com^$third-party
 ||cvhpuccaib.bid^$third-party
+||cvjzauehxjsy.com^$third-party
 ||cvnmmeux.com^$third-party
+||cvofpjhscrj.com^$third-party
+||cvupqfim.com^$third-party
 ||cvwipkjyu.bid^$third-party
+||cvwrspsdr.com^$third-party
+||cvzixxiesyjkha.com^$third-party
+||cwbbqhgtjbvtzi.com^$third-party
 ||cwdnbhhmdnm.com^$third-party
+||cwfikuwyjwnev.com^$third-party
 ||cwhuavlffzvhyi.bid^$third-party
 ||cwliihvsjckn.com^$third-party
 ||cwmxsgbllbee.bid^$third-party
 ||cwmycjoddoq.com^$third-party
 ||cwofongvtbsi.com^$third-party
 ||cwtekghutpaq.com^$third-party
+||cwvdzcqvg.com^$third-party
+||cwvqtapvqbmxfd.com^$third-party
 ||cwxblalyyvbj.com^$third-party
 ||cwxkywbndfue.com^$third-party
 ||cwxmevdteoxqi.com^$third-party
 ||cwxqufxcqopi.com^$third-party
+||cwyvnvukvkxqv.com^$third-party
 ||cwznlbsep.bid^$third-party
 ||cxgwwsapihlo.com^$third-party
 ||cxhfzipv.com^$third-party
@@ -40452,12 +38194,23 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||cxnxognwkuxm.com^$third-party
 ||cxoxruotepqgcvgqxdlwwucgyazmbkhdojqzihljdwwfeylovh.com^$third-party
 ||cxqevkkfhdqu.bid^$third-party
+||cxqmzfcfcwbwv.com^$third-party
 ||cxrmgoybhyrk.com^$third-party
+||cxunpvor.com^$third-party
+||cxxqchjb.com^$third-party
+||cxxsegmhltakq.com^$third-party
+||cxzisvjhpt.com^$third-party
 ||cybkhbkuobl.com^$third-party
+||cybzsdkmrqgy.com^$third-party
+||cyfzthaduxhb.com^$third-party
+||cygngisr.com^$third-party
+||cyhcpeprgy.com^$third-party
+||cymeeoolym.com^$third-party
 ||cymuxbcnhinm.com^$third-party
 ||cyrirvvrn.com^$third-party
 ||cyrrbejq.bid^$third-party
 ||cyssfnqt.com^$third-party
+||cytpfucbb.com^$third-party
 ||cyufjpvzaf.com^$third-party
 ||cywegkfcrhup.com^$third-party
 ||cyxagtpeggjv.com^$third-party
@@ -40473,14 +38226,19 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||czihyzbul.com^$third-party
 ||czjjyfnpyrs.bid^$third-party
 ||czkbmjsodcgr.bid^$third-party
+||czmolxvvrbb.com^$third-party
 ||czoivochvduv.com^$third-party
 ||czppmlbidjdx.com^$third-party
 ||czpspyovtiqn.com^$third-party
 ||czpwvmuznpj.bid^$third-party
+||czqrilwnayq.com^$third-party
 ||czrbkvvxyu.bid^$third-party
 ||czrtrfoin.com^$third-party
+||czsnzyykqzcreu.com^$third-party
 ||czuyzjyxlgirh.bid^$third-party
 ||czwdzqfnmzw.bid^$third-party
+||czzzwuvvc.com^$third-party
+||dacknbenn.com^$third-party
 ||dacqmkmsjajm.com^$third-party
 ||dadllrpazourna.com^$third-party
 ||daetemegxlyp.com^$third-party
@@ -40488,68 +38246,108 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||dahakbkwgvwzb.bid^$third-party
 ||daiwyihpjhdy.com^$third-party
 ||daizzagvvnv.com^$third-party
+||dajlkvplxyzbsa.com^$third-party
 ||dajoetsja.com^$third-party
+||daljntupdaoejb.com^$third-party
+||damihyugqet.com^$third-party
+||danunnpvy.com^$third-party
 ||daohvygdwvj.bid^$third-party
 ||dapvmnnttetuu.bid^$third-party
 ||daqdksam.bid^$third-party
+||davthnojr.com^$third-party
 ||daxnfpzmnfdr.com^$third-party
 ||daxzupqivdoj.com^$third-party
+||dbcxaicjyt.com^$third-party
 ||dbdndssvyxaltf.bid^$third-party
 ||dbesyixn.bid^$third-party
 ||dbftszei.bid^$third-party
 ||dbjcbnlwchgu.com^$third-party
 ||dbjsnxncaxnpp.com^$third-party
+||dbktgmyjph.com^$third-party
 ||dblnptdnyt.bid^$third-party
 ||dbmaptqxpjmsyr.bid^$third-party
+||dbmysjylbpwrav.com^$third-party
 ||dbojgaxhxalh.com^$third-party
 ||dbtaclpoahri.com^$third-party
 ||dbtglwtlxhysk.com^$third-party
+||dbuwkhpggim.com^$third-party
 ||dbwawnzkjniz.com^$third-party
 ||dbwohmscsgkhvz.bid^$third-party
 ||dbysmkeerpzo.com^$third-party
+||dccstsamnyrjk.com^$third-party
 ||dcdalkgtbmip.com^$third-party
 ||dcdqvukf.bid^$third-party
 ||dcgbswcvywyl.com^$third-party
+||dcjhpaexcwtc.com^$third-party
+||dckyimoylozbby.com^$third-party
 ||dclmmbjyshy.com^$third-party
 ||dcmatjqifoim.com^$third-party
 ||dcmhpbpdcsy.com^$third-party
 ||dcneohtx.com^$third-party
+||dcqhbqwlcukxu.com^$third-party
 ||dcqyyaprodclf.bid^$third-party
+||dcxitlzzmyxbwn.com^$third-party
 ||dcybolsar.bid^$third-party
+||dcyeufoq.com^$third-party
 ||dcznhkojghrl.com^$third-party
+||ddbnikwub.com^$third-party
 ||ddczayne.bid^$third-party
+||dddgndcqajr.com^$third-party
 ||ddhnjkaojrcv.bid^$third-party
 ||ddjodgzhxyjtaa.bid^$third-party
+||ddljcvtxfjtc.com^$third-party
+||ddmlzfwsb.com^$third-party
 ||ddprxzxnhzbq.com^$third-party
 ||debuackedhkvu.bid^$third-party
 ||deebwmbbytr.com^$third-party
+||degitlwfezpe.com^$third-party
 ||dehyogsjbk.bid^$third-party
+||deicslktis.com^$third-party
+||deiqehvcdnntg.com^$third-party
+||denixsips.com^$third-party
 ||deouvnqbgflv.com^$third-party
 ||deqrdwsjlpjz.com^$third-party
+||dergevqzqi.com^$third-party
 ||derpqpyvym.bid^$third-party
+||derqboxqca.com^$third-party
+||dewltdgzgtt.com^$third-party
 ||dexxxrggi.com^$third-party
 ||deyzjaiggwz.com^$third-party
+||dfawfyhesfe.com^$third-party
 ||dfbtmkwdcajsy.bid^$third-party
 ||dfcwecvmjtdj.com^$third-party
 ||dfgwnkricjcko.bid^$third-party
+||dfjaoecxqyox.com^$third-party
+||dfkpqvhcl.com^$third-party
 ||dfllzlsztzqwz.bid^$third-party
+||dfmedtntwcepqx.com^$third-party
 ||dfnnhwiyxjajhq.com^$third-party
+||dfomexjuokpuxi.com^$third-party
 ||dfrcdywe.com^$third-party
 ||dfrekewe.com^$third-party
 ||dfujqyjifvoe.com^$third-party
 ||dfxemnxrsal.bid^$third-party
 ||dgbhmpumhxy.bid^$third-party
 ||dgcxsmiavpg.bid^$third-party
+||dgeggjwyhkrr.com^$third-party
 ||dgfpsbezfeh.bid^$third-party
 ||dggcgurqynie.com^$third-party
 ||dgghbqysqzs.bid^$third-party
 ||dgjlfdvqb.bid^$third-party
+||dgkvriccq.com^$third-party
+||dglfkgmhahilp.com^$third-party
 ||dgmlubjidcxc.com^$third-party
 ||dgnjovmuao.bid^$third-party
 ||dgnqzxsw.bid^$third-party
+||dgnuumyxpqiget.com^$third-party
+||dgowzelhoaqqb.com^$third-party
+||dgqktjmxtlp.com^$third-party
+||dgrvnlhz.com^$third-party
+||dgucunmuibx.com^$third-party
 ||dgufzszbsk.bid^$third-party
 ||dgulomuzgkyjhe.bid^$third-party
 ||dgwrxyucxpizivncznkpmdhtrdzyyylpoeitiannqfxmdzpmwx.com^$third-party
+||dgwyckutalyqcn.com^$third-party
 ||dgycvdyncugrd.bid^$third-party
 ||dhaomvok.com^$third-party
 ||dhenktvqqmbcnj.bid^$third-party
@@ -40557,61 +38355,91 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||dhienrfamv.com^$third-party
 ||dhlnlwxspczc.com^$third-party
 ||dhmhdiozqbnq.com^$third-party
+||dhmwedckf.com^$third-party
 ||dhnxwgxszvi.com^$third-party
 ||dhomixidnkas.com^$third-party
 ||dhrjzwqpweidm.bid^$third-party
 ||dhsztvyjwcmk.com^$third-party
+||dhtqupvxujyfp.com^$third-party
+||dhuqolbvyla.com^$third-party
 ||dhvaigzy.com^$third-party
 ||dhvzrpvjwibr.com^$third-party
 ||dhxjrqegphza.bid^$third-party
 ||dhzmxkoq.bid^$third-party
 ||dibpvaoi.bid^$third-party
 ||didibvyl.bid^$third-party
+||dieohupl.com^$third-party
 ||difyt-m-tlb.co^$third-party
 ||digwzeutydo.com^$third-party
+||dijutbdzbv.com^$third-party
+||dillweqbducwi.com^$third-party
 ||dinmbegj.bid^$third-party
+||dipsbbygv.com^$third-party
 ||diqstzzbqin.bid^$third-party
 ||disbkzufvqhk.com^$third-party
 ||ditouyldfqgt.com^$third-party
 ||diuiyzhao.com^$third-party
 ||diwiosqupuecg.com^$third-party
 ||diwkemnk.bid^$third-party
+||diwtbtakcu.com^$third-party
 ||diysqcbfyuru.com^$third-party
+||djagrjpaoek.com^$third-party
 ||djavljmti.com^$third-party
 ||djbnmqdawodm.com^$third-party
 ||djcbhuwplfpui.bid^$third-party
 ||djeoxopgw.com^$third-party
 ||djhqkoikovr.bid^$third-party
+||djiufagozzla.com^$third-party
 ||djjckavq.com^$third-party
+||djnroblmpyxrh.com^$third-party
 ||djntmaplqzbi.com^$third-party
 ||djqercix.com^$third-party
 ||djrkauxla.bid^$third-party
 ||djtclldgsocbv.bid^$third-party
 ||djuxmbjauluis.com^$third-party
+||djvpsxtkdmga.com^$third-party
 ||djxvususwvso.com^$third-party
 ||djzmpsingsrtfsnbnkphyagxdemeagsiabguuqbiqvpupamgej.com^$third-party
 ||dkadbasc.bid^$third-party
 ||dkdnvbueigxs.bid^$third-party
 ||dkfdpglo.com^$third-party
 ||dkgdinrubwxro.bid^$third-party
+||dkgitkwo.com^$third-party
 ||dkjgyysfincxps.bid^$third-party
 ||dklvewbgjksyy.com^$third-party
+||dkmdklhu.com^$third-party
 ||dkrhsftochvzqryurlptloayhlpftkogvzptcmjlwjgymcfrmv.com^$third-party
+||dkroonzvxvansw.com^$third-party
+||dksvmumbi.com^$third-party
+||dktaqipmquo.com^$third-party
+||dktyjwldv.com^$third-party
 ||dkvblgxkihtys.bid^$third-party
 ||dkvzpqcqan.com^$third-party
+||dkxeorhjmua.com^$third-party
 ||dlahijuwjsv.com^$third-party
 ||dlemeyrkjy.com^$third-party
+||dlfdvyfn.com^$third-party
 ||dlganxfc.bid^$third-party
 ||dlntzbuskygwj.com^$third-party
+||dlotljikswmvq.com^$third-party
 ||dlpgebxqq.com^$third-party
+||dlpypwmo.com^$third-party
+||dlrwabzugcyj.com^$third-party
 ||dlsgjkayn.com^$third-party
+||dlwmksxohvw.com^$third-party
+||dlwssyqp.com^$third-party
 ||dlzksaqygxare.com^$third-party
 ||dmatquyckwtu.com^$third-party
 ||dmbjbgiifpfo.com^$third-party
 ||dmdcpvgu.com^$third-party
+||dmgcxznqmmiek.com^$third-party
 ||dmgexalrtsqrvx.com^$third-party
+||dmiqfxlnf.com^$third-party
 ||dmjcabavsraf.com^$third-party
+||dmkadnohjoqh.com^$third-party
+||dmnangpsbpm.com^$third-party
 ||dmojscqlwewu.com^$third-party
+||dmrqnwtyttd.com^$third-party
 ||dmsvdderirwbu.com^$third-party
 ||dmvegzsxaxn.com^$third-party
 ||dmvmnafx.com^$third-party
@@ -40619,75 +38447,114 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||dmxoedcqcb.com^$third-party
 ||dmyypseympjf.com^$third-party
 ||dneglbgcycpcab.bid^$third-party
+||dneliqkbeixeri.com^$third-party
 ||dneqghbwlmyjnj.com^$third-party
 ||dnewbvwrvadt.com^$third-party
+||dnftqfwycmfqrs.com^$third-party
 ||dngsuhxuzb.com^$third-party
 ||dnjxoflvkvec.com^$third-party
 ||dnntgcfejsg.bid^$third-party
 ||dnoucjqzsasm.com^$third-party
+||dnpehliwdvjkp.com^$third-party
 ||dnqejgrbtlxe.com^$third-party
 ||dnrtjavop.com^$third-party
+||dnrywryy.com^$third-party
 ||dnrzajdjq.com^$third-party
 ||dnsapimzlvmcis.com^$third-party
 ||dnsqqdordvpv.com^$third-party
 ||dntlpwpjwcfu.com^$third-party
 ||dnvndngbn.bid^$third-party
 ||dnxpseduuehm.com^$third-party
+||dnzevkqpk.com^$third-party
 ||dobgfkflsnmpaeetycphmcloiijxbvxeyfxgjdlczcuuaxmdzz.com^$third-party
 ||dobjgpqzygow.com^$third-party
+||docqacvwhgbxv.com^$third-party
 ||dodahirwudrhv.com^$third-party
 ||dodegomxh.bid^$third-party
 ||dodwnkpzaned.com^$third-party
 ||dohhehsgnxfl.com^$third-party
 ||doiljgzpurycgx.bid^$third-party
+||dojmlztmbrvp.com^$third-party
+||doksfyhdtqmipa.com^$third-party
 ||doljrizlsem.bid^$third-party
 ||domdtvbhgg.com^$third-party
+||donhyxngg.com^$third-party
 ||dosanrnlq.com^$third-party
 ||douangvwl.com^$third-party
 ||dovltuzibsfs.com^$third-party
 ||dpallyihgtgu.com^$third-party
+||dpbrrirhtlo.com^$third-party
 ||dpbviawkrumynm.com^$third-party
 ||dpkdwhfdrvxzcr.bid^$third-party
 ||dpmvpttamz.com^$third-party
 ||dpmyrskvbznvn.com^$third-party
+||dpnahzfbb.com^$third-party
+||dpoffxqjlgt.com^$third-party
+||dpoulbxouhor.com^$third-party
 ||dppcevxbshdl.com^$third-party
 ||dpqytzwxohcd.bid^$third-party
 ||dprdhzofq.bid^$third-party
 ||dpwmloknxtuw.com^$third-party
+||dpwrhdzeqw.com^$third-party
+||dpwsvrkmfxrt.com^$third-party
 ||dqcqavgqk.bid^$third-party
 ||dqdnwhyxeblt.com^$third-party
+||dqdwvmpez.com^$third-party
+||dqekudhbwprx.com^$third-party
 ||dqfhklmwj.com^$third-party
+||dqfpksnabgagc.com^$third-party
+||dqiokxyebdc.com^$third-party
 ||dqkeldpjzq.bid^$third-party
 ||dqlcgelw.com^$third-party
+||dqmfeimedqswbr.com^$third-party
+||dqolgbehhzvo.com^$third-party
 ||dqpamcouthqv.com^$third-party
 ||dqpywdubbxih.com^$third-party
 ||dqusbshqrtv.bid^$third-party
+||dqyczunj.com^$third-party
 ||drbwugautcgh.com^$third-party
 ||drcfjmkmy.com^$third-party
 ||drdvvfgqzwkutc.bid^$third-party
+||drjctivspweild.com^$third-party
+||drjwmuwmnll.com^$third-party
+||droqnswhcfk.com^$third-party
+||drpmtzjanjqjpj.com^$third-party
 ||drqjihcfdrqj.com^$third-party
 ||drragqvk.bid^$third-party
+||drsemkuhpg.com^$third-party
 ||drtqfejznjnl.com^$third-party
 ||drumuwimmzxqps.com^$third-party
+||drwfixovzqdcs.com^$third-party
 ||dsdiztki.bid^$third-party
+||dsemgngou.com^$third-party
 ||dsevjzklcjjb.com^$third-party
+||dsgjefwejkc.com^$third-party
 ||dsibzjqbtkjqd.bid^$third-party
 ||dskiepocq.bid^$third-party
 ||dsmysdzjhxot.com^$third-party
 ||dsnjsdrbqwdu.com^$third-party
 ||dswwghrlwwcm.com^$third-party
 ||dsxbgkphjyrngo.bid^$third-party
+||dsyxresmht.com^$third-party
+||dtgwjxeymdlri.com^$third-party
+||dthmzwzsgjibw.com^$third-party
 ||dtiwhkapsgva.bid^$third-party
+||dtjhwypfsayh.com^$third-party
 ||dtmwwpykiqng.com^$third-party
 ||dtnzlmwgujhgmj.bid^$third-party
 ||dtosduecka.com^$third-party
 ||dtpictvzcqqm.bid^$third-party
+||dtqcjtkytuqn.com^$third-party
 ||dtrwlquawlp.com^$third-party
+||dtuhvgjyrp.com^$third-party
+||dtusmzjdycvk.com^$third-party
+||dtvlalitvg.com^$third-party
 ||dtzlgtmqoj.bid^$third-party
 ||dubijsirwtwq.com^$third-party
 ||dubzmzpdkddi.com^$third-party
 ||duchmcmpmqqu.com^$third-party
 ||dueybqnkkhzdh.bid^$third-party
+||dugqbllwslqrlj.com^$third-party
 ||duhqtjmftpxrmn.bid^$third-party
 ||duidsdvdbecg.bid^$third-party
 ||duklamznlrn.com^$third-party
@@ -40695,23 +38562,37 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||dulfweycnqfoka.com^$third-party
 ||dulpsxaznlwr.com^$third-party
 ||dumoyqzxluou.com^$third-party
+||durowueoaxjhd.com^$third-party
 ||dusgihujnthv.com^$third-party
 ||dutvcvwebocux.bid^$third-party
 ||dutypzccyhr.com^$third-party
 ||duuewwbntvl.com^$third-party
 ||duumdqyt.bid^$third-party
 ||duvyjbofwfqh.com^$third-party
+||duwrigndkjp.com^$third-party
 ||duxyrxhfwilv.com^$third-party
 ||duyxfipwgrzwwd.bid^$third-party
 ||dvdbgvgagk.com^$third-party
+||dvdyicsndqbqo.com^$third-party
 ||dvgvwatnnqsmll.com^$third-party
+||dvhznawcuacblo.com^$third-party
+||dviavwhykcdp.com^$third-party
 ||dvlhwokr.bid^$third-party
+||dvokgydenwaksi.com^$third-party
+||dvpgijdm.com^$third-party
 ||dvprcchlzke.bid^$third-party
+||dvrttkoyngtnhi.com^$third-party
 ||dvsrlrnpyxwv.com^$third-party
+||dvszrkspd.com^$third-party
 ||dvzyppnmfgtr.com^$third-party
 ||dwabissw.com^$third-party
 ||dwbqmlvjpvv.com^$third-party
 ||dwentymgplvrizqhieugzkozmqjxrxcyxeqdjvcbjmrhnkguwk.com^$third-party
+||dwgfwxiecp.com^$third-party
+||dwhvkier.com^$third-party
+||dwopbruzifg.com^$third-party
+||dwuvmraztukg.com^$third-party
+||dwvfccxbj.com^$third-party
 ||dwxaciqlebqemh.com^$third-party
 ||dxcqavshmvst.com^$third-party
 ||dxdunwcdfrdqm.com^$third-party
@@ -40723,40 +38604,71 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||dxnglrimuuucmr.com^$third-party
 ||dxnzgeyxjhzym.com^$third-party
 ||dxokxbrfl.bid^$third-party
+||dxqorupwedbotu.com^$third-party
+||dxqxeklbsqe.com^$third-party
 ||dxtveuux.com^$third-party
 ||dxurtngzawwe.com^$third-party
+||dxyafwkhrnycjp.com^$third-party
+||dxzgoyzo.com^$third-party
+||dxzkrtpnwpp.com^$third-party
 ||dyazeqpeoykf.com^$third-party
+||dydxtkvmktumjp.com^$third-party
 ||dyerbegytfkj.com^$third-party
 ||dyhsubugnpw.bid^$third-party
+||dyhwaacbbntu.com^$third-party
 ||dyjifezeyagm.com^$third-party
 ||dyjkbkpzxgpjfs.com^$third-party
+||dylsjsmqjbbcs.com^$third-party
+||dymaffzxk.com^$third-party
+||dymzcxgdvf.com^$third-party
+||dypmzetaj.com^$third-party
 ||dyunhvev.com^$third-party
+||dywqwrtnhegyz.com^$third-party
 ||dyykxositkqt.bid^$third-party
 ||dyzstwcqbgjk.com^$third-party
 ||dz4ad.com^$third-party
+||dzacosgvnz.com^$third-party
+||dzaqzgjsot.com^$third-party
+||dzblysulli.com^$third-party
 ||dzdfmwaztrrm.com^$third-party
 ||dzehfozic.bid^$third-party
 ||dzhjqmlv.bid^$third-party
+||dzkmbajm.com^$third-party
 ||dzlaodil.com^$third-party
+||dzloxwupyxw.com^$third-party
 ||dzlpvqbyk.com^$third-party
 ||dzmstxov.bid^$third-party
+||dzqoubtxsaskdl.com^$third-party
 ||dzuklgyo.bid^$third-party
 ||dzwagxju.bid^$third-party
 ||dzyqqwixizp.com^$third-party
 ||dzzawlkmtvug.com^$third-party
+||dzztjcbt.com^$third-party
 ||eaaqsama.com^$third-party
 ||eabgoszdtq.com^$third-party
 ||eabrkvxoe.bid^$third-party
 ||eadtortust.bid^$third-party
 ||eaetyfmpuelw.com^$third-party
+||eaffxhnzh.com^$third-party
+||eaffzvnyj.com^$third-party
 ||eahkxyuezqvx.com^$third-party
 ||eaidabmuxbqy.com^$third-party
+||eaknxurdsogwr.com^$third-party
+||eaolnbvd.com^$third-party
+||eaoxitwrlr.com^$third-party
 ||easmdmxps.com^$third-party
 ||easnviytengk.com^$third-party
 ||easygatepr.bid^$third-party
+||eayyegrkujxcw.com^$third-party
+||ebbhjxspf.com^$third-party
 ||ebbldazyvt.com^$third-party
 ||ebfjbrlcvjlv.com^$third-party
+||ebfkifnjs.com^$third-party
 ||ebfoxoedfyi.com^$third-party
+||ebgaxsjgdsnr.com^$third-party
+||ebhytolzhum.com^$third-party
+||ebicjwvxmygdqr.com^$third-party
+||ebifuaad.com^$third-party
 ||ebmoorfskily.com^$third-party
 ||ebnfsjxs.bid^$third-party
 ||ebrvuzqkq.bid^$third-party
@@ -40769,6 +38681,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||ecmeqhxevxgmtoxubrjstrrlyfgrrtqhvafyagettmwnwkwltn.com^$third-party
 ||ectbduztanog.com^$third-party
 ||ectxnsxezdg.com^$third-party
+||ectysptouy.com^$third-party
 ||ecvladelayk.com^$third-party
 ||ecxtuyttpfe.bid^$third-party
 ||edfthzanlsyse.com^$third-party
@@ -40780,7 +38693,10 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||edudktabmq.bid^$third-party
 ||edvbyybaviln.com^$third-party
 ||edwywpsufuda.com^$third-party
+||edxosrcvydn.com^$third-party
 ||edxvyyywsxqh.com^$third-party
+||edyjiqxeppjkj.com^$third-party
+||eeamatyc.com^$third-party
 ||eebrojmn.com^$third-party
 ||eecetnnsdz.bid^$third-party
 ||eedicjfwqhqr.bid^$third-party
@@ -40788,17 +38704,25 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||eedsgikkbtn.bid^$third-party
 ||eefbzuwvnnab.com^$third-party
 ||eefiwmtwppppay.com^$third-party
+||eefiywjjzxry.com^$third-party
 ||eehdssnxola.com^$third-party
 ||eejcqlenlsko.com^$third-party
+||eekkanwe.com^$third-party
+||eekmkywfke.com^$third-party
 ||eelwibevmywtz.com^$third-party
+||eencosteptffo.com^$third-party
 ||eepuawuevovi.com^$third-party
 ||eeqabqioietkquydwxfgvtvpxpzkuilfcpzkplhcckoghwgacb.com^$third-party
 ||eeqlxzpqqaii.com^$third-party
 ||eerdckbwujcx.com^$third-party
+||eernnfbfby.com^$third-party
 ||eexnoxqcmrja.com^$third-party
 ||efbxevtnq.com^$third-party
 ||efcnevmojvfs.com^$third-party
+||efebafmqn.com^$third-party
+||efekvyyynwd.com^$third-party
 ||efhevptuqxpr.bid^$third-party
+||efhseqgqgl.com^$third-party
 ||efjucmgdzexeab.com^$third-party
 ||efkxhoeoqsv.bid^$third-party
 ||efluqmlyzi.com^$third-party
@@ -40807,7 +38731,10 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||efotdwuui.bid^$third-party
 ||efsjxinbtzirs.bid^$third-party
 ||efukznkfmrck.com^$third-party
+||efzhzqtyomldfj.com^$third-party
+||egcocjwpzqsa.com^$third-party
 ||egcsbdrj.com^$third-party
+||eghuntsrizvbt.com^$third-party
 ||egkkeahdzjqy.com^$third-party
 ||egouyziyto.bid^$third-party
 ||egqvfdht.bid^$third-party
@@ -40820,10 +38747,13 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||ehcawmdqgq.com^$third-party
 ||eheewlwlebwpd.com^$third-party
 ||ehfmhsqzxfrsz.bid^$third-party
+||ehhmynitx.com^$third-party
 ||ehkovmky.com^$third-party
+||ehlfynuo.com^$third-party
 ||ehlnakqlcvuxk.bid^$third-party
 ||ehnjtmqchrub.com^$third-party
 ||ehoksipmkejqt.bid^$third-party
+||ehraxliuwt.com^$third-party
 ||ehrwekypesnl.bid^$third-party
 ||ehrxkeosifmksi.bid^$third-party
 ||ehuomemzh.com^$third-party
@@ -40846,26 +38776,45 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||eizzndhkvl.bid^$third-party
 ||ejbvrgespr.bid^$third-party
 ||ejdcjjcqcnzhre.bid^$third-party
+||ejgdixiddmruql.com^$third-party
 ||ejgxyfzciwyi.com^$third-party
 ||ejjgrmutgrdwxg.com^$third-party
 ||ejjrckrhigez.com^$third-party
 ||ejkoolhhepojeu.com^$third-party
+||ejlsbfqqxoc.com^$third-party
+||ejoyjumnsft.com^$third-party
 ||ejwmxjttljbe.com^$third-party
 ||ejwocojjv.bid^$third-party
+||ejwxbwzrhihtp.com^$third-party
+||ekbiwwngwig.com^$third-party
 ||ekdamsibldrg.bid^$third-party
 ||ekdjdrmqqlc.bid^$third-party
+||ekggptrw.com^$third-party
 ||ekgmjxjyfzzd.com^$third-party
 ||ekhgvpsfrwqm.com^$third-party
 ||ekiickqfxqtp.bid^$third-party
 ||ekiytcllwboe.com^$third-party
+||eklcrpehu.com^$third-party
 ||ekmunhjbh.bid^$third-party
+||ekmztfadigi.com^$third-party
+||eknfrwtxsde.com^$third-party
+||ekuuarqe.com^$third-party
+||ekxfupdlyst.com^$third-party
+||ekxlneryaiefwn.com^$third-party
 ||ekzstfriawl.bid^$third-party
+||elatsadlux.com^$third-party
 ||elbeobjhnsvh.com^$third-party
+||elcolpplwua.com^$third-party
+||elfnwncr.com^$third-party
+||elimpfdlss.com^$third-party
 ||eljjyutgjiuh.com^$third-party
 ||elkpxsfzrubq.com^$third-party
+||eloumbsyd.com^$third-party
 ||elsgsgxywj.bid^$third-party
 ||eluhhfyxx.com^$third-party
+||elvfmxguozafu.com^$third-party
 ||elvirvln.com^$third-party
+||elwbhndbxfqk.com^$third-party
 ||elwwxuigpk.bid^$third-party
 ||elxkjyvdo.bid^$third-party
 ||elxxkpaeudxu.com^$third-party
@@ -40887,8 +38836,11 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||emxbuugvudofbc.bid^$third-party
 ||emxfructugey.com^$third-party
 ||emxwkunx.bid^$third-party
+||emxztiidh.com^$third-party
 ||emzotevsto.com^$third-party
+||emzxewhgjt.com^$third-party
 ||encvhiseje.bid^$third-party
+||endcgwkclhtnk.com^$third-party
 ||enfhddbnariw.com^$third-party
 ||enfupatujiqb.com^$third-party
 ||enheqjtrvkn.bid^$third-party
@@ -40896,17 +38848,30 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||enhwftpkwvnb.com^$third-party
 ||eniaypwywduf.com^$third-party
 ||ennwwuxijwjgdm.bid^$third-party
+||enokjulejktukh.com^$third-party
+||entlydazhcmlgx.com^$third-party
+||entygpeb.com^$third-party
+||enusbrzlmcmg.com^$third-party
+||enynwkvdb.com^$third-party
 ||enzyxtdcacde.com^$third-party
 ||eociaoqs.bid^$third-party
 ||eocnpszthsf.com^$third-party
 ||eoecdsfvceebrv.com^$third-party
 ||eoepqqkg.com^$third-party
+||eofaplocyrcxhq.com^$third-party
 ||eojrldtucqsf.com^$third-party
+||eoqsbpvdxllxo.com^$third-party
+||eoruxpqn.com^$third-party
+||eotbkgjqu.com^$third-party
 ||eovkzcueutgf.com^$third-party
+||eozbwwxniksmb.com^$third-party
+||epbathcyav.com^$third-party
 ||epernepojkle.com^$third-party
 ||epesogtigole.com^$third-party
 ||epgokiocquxf.com^$third-party
 ||epgooipixbbo.com^$third-party
+||ephtwbxuqy.com^$third-party
+||eplocjhuxsoj.com^$third-party
 ||eplsshzbotknz.bid^$third-party
 ||epndtinso.com^$third-party
 ||epnjahss.com^$third-party
@@ -40914,27 +38879,41 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||epsiulpa.com^$third-party
 ||eptwulil.com^$third-party
 ||epvhmxyqa.bid^$third-party
+||epxokmckjkj.com^$third-party
 ||epxxqzrcdfkxo.bid^$third-party
 ||epzxtposabej.com^$third-party
 ||eqcvisodkvphw.bid^$third-party
+||eqdlypxvit.com^$third-party
 ||eqegggmtc.com^$third-party
+||eqezqqdpjmxbpb.com^$third-party
+||eqfnhtthkog.com^$third-party
+||eqhawyidkdug.com^$third-party
 ||eqkccjinroye.bid^$third-party
 ||eqonwbgcqi.bid^$third-party
 ||eqqhbzmaf.bid^$third-party
 ||eqqhiwfjcfx.bid^$third-party
+||eqrbfjwnmxpy.com^$third-party
 ||eqszmuwnozvx.com^$third-party
 ||eraeoggritjeo.com^$third-party
 ||erahvrtzbg.com^$third-party
 ||erbsqnmglmnv.com^$third-party
 ||erckgobvi.com^$third-party
 ||erhpodgijusvi.bid^$third-party
+||erificyggw.com^$third-party
+||erireiejv.com^$third-party
 ||erkwkjfompvt.com^$third-party
+||ermjhgdl.com^$third-party
 ||erqqhfsu.com^$third-party
 ||erszwzaidmlc.com^$third-party
+||erucjvsest.com^$third-party
+||ervinguewty.com^$third-party
 ||ervpgpxr.com^$third-party
+||erxvdkrivto.com^$third-party
 ||erzrulbjdd.bid^$third-party
 ||esdykqhupjp.com^$third-party
 ||esfqqfqagkkbrl.com^$third-party
+||esfzbdwg.com^$third-party
+||esgnyfznnihl.com^$third-party
 ||esgvhaspsjg.com^$third-party
 ||esgwceckxumg.com^$third-party
 ||eshezwwft.com^$third-party
@@ -40944,27 +38923,45 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||espnrlezwzvd.com^$third-party
 ||esqjuilubnaoey.com^$third-party
 ||esrpxyahzna.bid^$third-party
+||essjetuhfuo.com^$third-party
+||esundpxbixeqgu.com^$third-party
 ||esznfpbro.com^$third-party
+||eszpmsipks.com^$third-party
 ||etbmvqjnfxtk.com^$third-party
 ||etbrjgpsadke.com^$third-party
+||etekxogwxx.com^$third-party
 ||etggealva.com^$third-party
 ||etggiddfdaqd.com^$third-party
 ||etglnloj.com^$third-party
+||etihenbteb.com^$third-party
+||etizspyjmjhxo.com^$third-party
+||etkdximarcsq.com^$third-party
+||etkhujhmhjix.com^$third-party
+||etmewatuh.com^$third-party
 ||etprpfuw.bid^$third-party
 ||etsqitgro.bid^$third-party
 ||ettamscqyvocxz.com^$third-party
+||etuihxnhuxrofl.com^$third-party
 ||etvtabeas.com^$third-party
 ||etwgydlbl.bid^$third-party
 ||etyeltdqg.bid^$third-party
 ||etytypmuykf.bid^$third-party
+||etyxitxlvqp.com^$third-party
 ||euarbohjj.com^$third-party
+||eudcmqdyl.com^$third-party
 ||eueukpcxjtxt.bid^$third-party
+||eugxcnqw.com^$third-party
 ||euhewiruckv.com^$third-party
 ||eunysqxppf.bid^$third-party
 ||eupwogkcjczz.com^$third-party
 ||eurifsiooyof.bid^$third-party
+||eutdrjvsrmav.com^$third-party
 ||eutklhuazxlt.com^$third-party
+||eutsbhvtao.com^$third-party
+||euuikdao.com^$third-party
+||euwyhbib.com^$third-party
 ||euxisszoyader.com^$third-party
+||evepcynlxks.com^$third-party
 ||evfatcuv.com^$third-party
 ||evfwfkwufbjtd.com^$third-party
 ||evfzqbbdif.bid^$third-party
@@ -40972,49 +38969,73 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||evhvoeqfrlsb.com^$third-party
 ||evimfftxa.com^$third-party
 ||evlvaulglzpu.com^$third-party
+||evnksnocq.com^$third-party
 ||evntcmetzefbv.bid^$third-party
 ||evszxlad.com^$third-party
 ||evtfjieqjhvf.com^$third-party
+||evuchenzypysci.com^$third-party
+||evvpibrfqzjn.com^$third-party
 ||ewaosdzofcsy.bid^$third-party
 ||ewbejjirdygik.com^$third-party
 ||ewccxwve.bid^$third-party
+||ewgnexykqnyoun.com^$third-party
 ||ewgtanybkkch.com^$third-party
+||ewlnukukkca.com^$third-party
+||ewopxadcn.com^$third-party
 ||ewpqmptpavn.com^$third-party
+||ewrdeqrktgcu.com^$third-party
 ||ewsawnbf.com^$third-party
 ||ewxssoad.bid^$third-party
 ||ewzsfpskdfuip.com^$third-party
 ||ewzwkgyrpk.bid^$third-party
 ||exaorwqrj.bid^$third-party
+||exbphrqpqukm.com^$third-party
 ||excqjoor.com^$third-party
 ||exdcbyzgwfvwa.com^$third-party
 ||exekiksakspujl.com^$third-party
 ||exeroearu.bid^$third-party
 ||exioptyxiyoo.com^$third-party
 ||exjthrzliajfd.com^$third-party
+||exkruwviyy.com^$third-party
 ||exmubrgt.bid^$third-party
 ||exnyzdboihvi.com^$third-party
 ||exqaxblsmev.com^$third-party
+||exrnrdnebas.com^$third-party
 ||exsuqfxv.bid^$third-party
 ||exucfbmppagqta.bid^$third-party
 ||exvgzhwssyivz.bid^$third-party
 ||exvmxqexedomi.com^$third-party
+||exyubuwtwmepqi.com^$third-party
 ||eydiuqpdtfew.com^$third-party
 ||eyinwxkojgkfgs.com^$third-party
 ||eyjuwcrnu.bid^$third-party
 ||eylefeyrwl.com^$third-party
 ||eylyitpslpqu.com^$third-party
+||eyqletzkhybsef.com^$third-party
+||eytoshab.com^$third-party
+||eytqtjpjnmeas.com^$third-party
 ||ezbbxqocxnto.com^$third-party
 ||ezbtpdjeimlv.com^$third-party
 ||ezdariijmdlg.bid^$third-party
 ||ezemyudhkzvx.com^$third-party
 ||ezfncojpnrmj.com^$third-party
+||ezgswchaz.com^$third-party
+||ezhinpwh.com^$third-party
 ||ezhkfxskimqnqk.com^$third-party
+||ezjepifcz.com^$third-party
 ||ezjrnbpjthir.com^$third-party
 ||ezkbzmwigo.bid^$third-party
 ||ezknqsblzmsl.com^$third-party
+||ezlxnyhbjtqr.com^$third-party
+||ezqldmevi.com^$third-party
+||ezrutveckpuly.com^$third-party
+||eztfsnnttpqfs.com^$third-party
+||ezuereisgj.com^$third-party
 ||ezuosstmbcle.com^$third-party
+||fabrtgzehf.com^$third-party
 ||facqgdunsgf.com^$third-party
 ||facsowlaufzk.com^$third-party
+||faegbmhey.com^$third-party
 ||fafmybvsoj.com^$third-party
 ||faftjhuu.com^$third-party
 ||fahowtxv.bid^$third-party
@@ -41023,24 +39044,39 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||faleaqotrgvox.bid^$third-party
 ||famztplbta.bid^$third-party
 ||faoxietqwbmu.com^$third-party
+||faqflcoaovd.com^$third-party
 ||farkkbndawtxczozilrrrunxflspkyowishacdueiqzeddsnuu.com^$third-party
+||farvqaxaoid.com^$third-party
 ||fatayvywbebgdn.com^$third-party
 ||fawhiybzs.bid^$third-party
+||faykdrhpo.com^$third-party
 ||fbafbbujy.com^$third-party
 ||fbauhaozc.bid^$third-party
 ||fbbjlubvwmwd.com^$third-party
+||fbekvzjp.com^$third-party
+||fbhfbgtj.com^$third-party
 ||fbhgryvzlthvh.com^$third-party
 ||fbkdhxkd.com^$third-party
+||fbknvrvouex.com^$third-party
+||fbmgmcerkou.com^$third-party
 ||fbnvqmorr.com^$third-party
+||fbpetrwt.com^$third-party
 ||fbtfhgydrovyxs.com^$third-party
 ||fbvvuwtejcvdza.com^$third-party
 ||fbwswktiaxmldz.com^$third-party
 ||fbzfudipxwtu.bid^$third-party
+||fcbykurluasdeu.com^$third-party
+||fcihwhsiukz.com^$third-party
 ||fcjhxlybaiab.com^$third-party
 ||fcjiqwghf.bid^$third-party
 ||fcjnqpkrdglw.com^$third-party
+||fcjodgfpjiswa.com^$third-party
+||fclfmfjykupjdk.com^$third-party
+||fcpispplqq.com^$third-party
 ||fcveilhtok.com^$third-party
+||fcwpxsmiyy.com^$third-party
 ||fdbqwtqdgcsceh.com^$third-party
+||fdbrwxtm.com^$third-party
 ||fdbyfnpdcqc.bid^$third-party
 ||fddbdlolkxgc.com^$third-party
 ||fdepobamndfn.com^$third-party
@@ -41051,32 +39087,50 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||fdjdyzoqnzikx.bid^$third-party
 ||fdnxojzwbmie.bid^$third-party
 ||fdogfuqpgeub.com^$third-party
+||fdrkesvb.com^$third-party
+||fdrqokusnwpq.com^$third-party
 ||fdtvsqnkujlwaa.bid^$third-party
 ||fduyzzjazngphw.bid^$third-party
 ||fdvmskmentjob.com^$third-party
+||fdxdjkswppg.com^$third-party
+||fdxsswtgvshhe.com^$third-party
+||fdzylxffu.com^$third-party
 ||feacamnliz.bid^$third-party
+||febalwby.com^$third-party
+||fecgvrvne.com^$third-party
 ||fefzohgedqp.com^$third-party
 ||fegyacmbobil.com^$third-party
+||fehsnwiem.com^$third-party
+||fejbkpidkkwts.com^$third-party
 ||fembsflungod.com^$third-party
 ||fengrtnoxuwwe.com^$third-party
+||fepzygektdt.com^$third-party
 ||feqlklwaafgc.com^$third-party
 ||feqyuubaixe.bid^$third-party
+||fevgukzwvjam.com^$third-party
+||fevrbniqa.com^$third-party
 ||ffahsidlivqb.bid^$third-party
 ||ffanszicnoqs.com^$third-party
+||ffaspwzfq.com^$third-party
+||ffbqnbdcrx.com^$third-party
 ||ffbuqvnst.bid^$third-party
+||ffcqkvdaklrqkg.com^$third-party
 ||ffdkffnj.com^$third-party
 ||fffzquckf.com^$third-party
 ||ffhwzaenzoue.com^$third-party
+||ffjzebtmdwi.com^$third-party
 ||ffkwprrdmyaj.bid^$third-party
 ||ffmhgdnkdcs.com^$third-party
 ||ffoifngclwfuey.com^$third-party
 ||ffpkqjyvvneg.com^$third-party
+||ffpnlrnmfyeqx.com^$third-party
 ||ffpyofnpq.com^$third-party
 ||ffrsfowwxtlbu.com^$third-party
 ||ffvbcwueh.com^$third-party
 ||ffvghouburgijz.bid^$third-party
 ||ffvvapasfcoha.bid^$third-party
 ||ffwbpadvkcyi.com^$third-party
+||ffxobftzaiogcg.com^$third-party
 ||fgcterkdpns.com^$third-party
 ||fghdembabvwe.com^$third-party
 ||fghtrrasovlsu.com^$third-party
@@ -41084,24 +39138,35 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||fgkvpyrmkbap.com^$third-party
 ||fglwxjklf.com^$third-party
 ||fgmucsiirrsq.com^$third-party
+||fgnzizhe.com^$third-party
+||fgsjjpjhdlfthp.com^$third-party
+||fgsmmpazsuqak.com^$third-party
+||fgtdzvlydqcpus.com^$third-party
+||fgtskhlizoitz.com^$third-party
 ||fgvjjulaegidb.com^$third-party
 ||fgwsjwiaqtjc.com^$third-party
 ||fgxgzjeip.bid^$third-party
 ||fgyeepfitnvkzz.com^$third-party
 ||fgzaxilcgxum.com^$third-party
+||fgzxlngohtg.com^$third-party
 ||fhawywadfjlo.com^$third-party
 ||fhgstzgrdhkah.bid^$third-party
 ||fhjciatocm.bid^$third-party
+||fhluqrhmqs.com^$third-party
 ||fhlzfxxnqc.com^$third-party
 ||fhqornueunf.com^$third-party
+||fhsohqtif.com^$third-party
 ||fhsxhewkajqwgf.bid^$third-party
+||fhtlyoqzyjjof.com^$third-party
 ||fhxmqthpjswm.bid^$third-party
 ||fhylnqzxwsbo.com^$third-party
 ||fhzgapsfnlsvx.bid^$third-party
 ||fiarnvygamgpqf.com^$third-party
 ||fieejwanbrv.com^$third-party
+||fifnonxntvaszg.com^$third-party
 ||fikyzmbuhql.bid^$third-party
 ||filenlgic.bid^$third-party
+||finsbfaizzx.com^$third-party
 ||fioeazluwwirp.bid^$third-party
 ||fiqkmfapvnntn.bid^$third-party
 ||firflzsngsg.bid^$third-party
@@ -41110,44 +39175,63 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||fiuazbmlycese.com^$third-party
 ||fiunfrafi.bid^$third-party
 ||fjcvncxrmmru.com^$third-party
+||fjczvutpucr.com^$third-party
+||fjeqkpblfb.com^$third-party
 ||fjfxpykp.com^$third-party
 ||fjlvozwlv.bid^$third-party
 ||fjmjlwvtv.bid^$third-party
 ||fjmxpixte.bid^$third-party
+||fjocjdbo.com^$third-party
 ||fjqngeqkhlruto.bid^$third-party
 ||fjrlvkpjfimw.com^$third-party
+||fjszsffyfihqlg.com^$third-party
 ||fjuouqwxgbir.com^$third-party
 ||fjvolzrojowa.com^$third-party
+||fjwagiuqmeymw.com^$third-party
 ||fjxdsslczu.bid^$third-party
 ||fjxlbkwhtpil.com^$third-party
+||fjxssyatdwttqm.com^$third-party
 ||fjyapvqvgjmwy.com^$third-party
 ||fkdqrjnoxhch.com^$third-party
 ||fkdslgyunikais.com^$third-party
 ||fkekipafwlqd.com^$third-party
 ||fkemshukccjvu.com^$third-party
+||fkfmujcudpwdn.com^$third-party
 ||fkianrxjfumm.com^$third-party
 ||fkivuntlyd.bid^$third-party
 ||fkjyzxnoxusg.com^$third-party
 ||fkkjsdpppv.bid^$third-party
 ||fkpbbmgqa.bid^$third-party
 ||fkphqtgqrfixl.com^$third-party
+||fkrgfktdvta.com^$third-party
 ||fkrrvhoierty.com^$third-party
+||fktrlckpmsxx.com^$third-party
+||fkvjntfj.com^$third-party
 ||fkwwhndzjlqrm.com^$third-party
+||flbecoidmt.com^$third-party
 ||flcfstbzncsim.com^$third-party
 ||fldlyzvhgjq.com^$third-party
+||flepzrkdwm.com^$third-party
+||flgstgrcwapk.com^$third-party
+||flirrfbpb.com^$third-party
 ||flkyhwjhp.com^$third-party
 ||flmditew.com^$third-party
+||flnqkhnqjcmvp.com^$third-party
 ||flntdbwafec.com^$third-party
 ||flooaiaubf.bid^$third-party
+||flrqdjglshsbi.com^$third-party
 ||fluohbiy.com^$third-party
 ||fluunrkjjhv.com^$third-party
+||flvuylhsyg.com^$third-party
 ||flzelfqolfnf.com^$third-party
 ||fmbjxqvkjfmj.com^$third-party
+||fmcktrmnlyfjr.com^$third-party
 ||fmcwqmwdaubb.com^$third-party
 ||fmgcaqljz.bid^$third-party
 ||fmoihhvbehopc.com^$third-party
 ||fmpsrqsib.bid^$third-party
 ||fmuxugcqucuu.com^$third-party
+||fmxnlkoaf.com^$third-party
 ||fmztxzdrq.bid^$third-party
 ||fmzxzkgmpmrx.com^$third-party
 ||fnacxthxbgmmmo.bid^$third-party
@@ -41155,64 +39239,110 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||fnayazchhum.com^$third-party
 ||fnbhjbcfqkrcs.com^$third-party
 ||fneheruhxqtv.com^$third-party
+||fnfhplmys.com^$third-party
+||fngoubeq.com^$third-party
 ||fnhogffqzmcqj.com^$third-party
 ||fnjcriccyuna.com^$third-party
 ||fnjzuwviiyedmp.com^$third-party
 ||fnkyyrgraizy.com^$third-party
+||fnmubgld.com^$third-party
+||fnprtscsvux.com^$third-party
 ||fnsjfalwuti.bid^$third-party
 ||fnutdrjkcebyw.com^$third-party
+||fnuuhrhfkvpbnm.com^$third-party
 ||fnzpchmrhlpfzl.bid^$third-party
 ||foabezckdiv.bid^$third-party
 ||fobjoccwkrkv.com^$third-party
+||fofjazpwccc.com^$third-party
 ||foguumjql.com^$third-party
 ||fojgpvkhu.com^$third-party
 ||fokisduu.com^$third-party
 ||foovyagf.com^$third-party
+||foqzposfvmk.com^$third-party
+||fosclhrsdhhn.com^$third-party
+||foswrohqoadp.com^$third-party
 ||fpbmjwoebzby.com^$third-party
+||fpcptdqmjlnlu.com^$third-party
+||fpdsavexteno.com^$third-party
+||fpfivothg.com^$third-party
 ||fpguuwnpkvqsq.bid^$third-party
+||fpherzxrae.com^$third-party
+||fpluhtibx.com^$third-party
 ||fpnxicejwel.com^$third-party
+||fpoxpjpxn.com^$third-party
 ||fppgjkkjq.bid^$third-party
 ||fppupmqbydpk.com^$third-party
+||fpqeowmsv.com^$third-party
 ||fpqippsowc.bid^$third-party
 ||fpqxcvrewdqd.com^$third-party
 ||fpriycwxw.com^$third-party
 ||fpsezlguzzqmfw.bid^$third-party
 ||fpslcnjecewd.com^$third-party
+||fpsnezwiumsv.com^$third-party
+||fpunplooxphq.com^$third-party
 ||fpvfeyjrwlio.com^$third-party
+||fpxkjlzmkqp.com^$third-party
+||fpxthotxzuf.com^$third-party
+||fpzcaabzhvzz.com^$third-party
+||fpzcyccpqldc.com^$third-party
 ||fpzxmdjjpphzc.bid^$third-party
+||fqanilbgne.com^$third-party
 ||fqazjwxovxlu.com^$third-party
+||fqbrdnpf.com^$third-party
+||fqckdxjgle.com^$third-party
 ||fqemzrkwuiaq.bid^$third-party
 ||fqesuuyzhxpz.bid^$third-party
 ||fqgqosvpodxn.com^$third-party
+||fqhpssdbenl.com^$third-party
 ||fqjevuoat.com^$third-party
 ||fqkcdhptlqma.com^$third-party
+||fqldrulyjfnt.com^$third-party
 ||fqleehzafh.com^$third-party
 ||fqmxwckinopg.com^$third-party
 ||fqnabpbdljzq.bid^$third-party
 ||fqovfxpsytxf.com^$third-party
 ||fqpfvqpptch.com^$third-party
 ||fqpteozo.com^$third-party
+||fqqtlkuklrd.com^$third-party
 ||fqrcutjorn.com^$third-party
 ||fqsdlhaffr.bid^$third-party
 ||fqtpulizvvjcf.com^$third-party
+||fqufpknrarn.com^$third-party
+||frbhjvazapgo.com^$third-party
+||frcinpdv.com^$third-party
 ||frczfzikturw.com^$third-party
 ||frcznmfu.com^$third-party
 ||frddujheozns.com^$third-party
 ||frdhsmerubfg.com^$third-party
 ||frefxzrmcdxdmi.com^$third-party
+||frereadayobq.com^$third-party
 ||frezshmura.bid^$third-party
+||frfgfhzxtfvsp.com^$third-party
 ||frkohfqkpwvvq.com^$third-party
 ||frlvfzybstsa.com^$third-party
 ||frlzxwxictmg.com^$third-party
 ||frmavvtkhi.bid^$third-party
 ||frmwbxzynkrswj.com^$third-party
 ||frmxnnjejpzbr.com^$third-party
+||frqmnrlqk.com^$third-party
+||frtfwlvwuw.com^$third-party
 ||frtkblgbqc.bid^$third-party
 ||frxgmxkg.bid^$third-party
+||frxohovv.com^$third-party
+||fryxaknn.com^$third-party
 ||fsapltvckyb.bid^$third-party
+||fscslwmvbadncb.com^$third-party
 ||fsddidfmmzvw.com^$third-party
+||fsdvydpldxrbu.com^$third-party
+||fsiadjbirgobi.com^$third-party
+||fsindvlkmrqnie.com^$third-party
+||fsjvhkobubai.com^$third-party
 ||fskheghrote.com^$third-party
+||fsmpxxdyv.com^$third-party
+||fsnhesxsw.com^$third-party
+||fsohxklbxdi.com^$third-party
 ||fsqgojinc.bid^$third-party
+||fsqknqvlngde.com^$third-party
 ||fsrmspghkuyn.bid^$third-party
 ||fssesicszubztp.bid^$third-party
 ||fsuhjykihmqpt.bid^$third-party
@@ -41221,37 +39351,63 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||fsxmtpvumpty.bid^$third-party
 ||ftbiufcomsa.bid^$third-party
 ||ftbnrjzvgtdyzs.bid^$third-party
+||ftcjcmcovx.com^$third-party
 ||ftdyrqgjr.bid^$third-party
 ||ftfnchzmnyl.com^$third-party
 ||ftgfmbxqkjda.com^$third-party
 ||ftisvrpsfu.bid^$third-party
 ||ftjrekbpjkwe.com^$third-party
 ||ftodxdoolvdm.com^$third-party
+||ftqgkcmbkptohh.com^$third-party
 ||ftqhgapqugv.bid^$third-party
+||ftqnttckompj.com^$third-party
 ||fttsgimpiagrwa.com^$third-party
+||ftttziizhuplfj.com^$third-party
 ||ftuisdlnbp.com^$third-party
+||ftuohzeijbkm.com^$third-party
 ||ftusprfqtu.bid^$third-party
 ||ftvkgkkmthed.com^$third-party
+||ftvwoljibdwd.com^$third-party
 ||ftwdbhsztw.com^$third-party
+||ftxekufylzqis.com^$third-party
 ||ftymjfywuyv.com^$third-party
+||ftymzxmic.com^$third-party
 ||ftytssqazcqx.com^$third-party
+||fuaawvoqbzza.com^$third-party
 ||fubhyuveurmlz.com^$third-party
 ||fuckaqunrcjj.bid^$third-party
 ||fucrzdux.bid^$third-party
 ||fuhgvhuukl.bid^$third-party
+||fuialqqq.com^$third-party
 ||fukchwgbsl.com^$third-party
+||fukkzdxfyrchhc.com^$third-party
+||fupgvldb.com^$third-party
 ||fuurqgbfhvqx.com^$third-party
+||fuwgbbkktwbu.com^$third-party
+||fuxhdhdjlyrwhq.com^$third-party
+||fuymatqqiyz.com^$third-party
 ||fvbeyduylvgy.com^$third-party
 ||fvbtqaijuo.com^$third-party
+||fveegvyfe.com^$third-party
+||fvenxjtzuaxu.com^$third-party
+||fveugxikrgrbsh.com^$third-party
 ||fvffhcyxc.com^$third-party
 ||fvgfcotnmj.com^$third-party
 ||fvhxlrcd.com^$third-party
 ||fvipinzac.com^$third-party
+||fviwwkvvxs.com^$third-party
 ||fvkdatbzswo.bid^$third-party
 ||fvozquqvnuv.bid^$third-party
+||fvpluqipfjcsf.com^$third-party
 ||fvrbloxygbrv.com^$third-party
 ||fvrvxmksxhut.com^$third-party
+||fvsdvxjpxi.com^$third-party
+||fvtwyjev.com^$third-party
 ||fvwcwbdrprdt.com^$third-party
+||fvwfkfzhha.com^$third-party
+||fvzompquocgdsu.com^$third-party
+||fvzusqdf.com^$third-party
+||fwbhvrpiunlzyh.com^$third-party
 ||fwcrhzvfxoyi.com^$third-party
 ||fwenfotroadh.bid^$third-party
 ||fwfgbhjhnlkv.com^$third-party
@@ -41265,42 +39421,66 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||fwslcjmfdqyvmg.com^$third-party
 ||fwutbizwevr.com^$third-party
 ||fwvfntvmhhxx.bid^$third-party
+||fwwdmnkjg.com^$third-party
 ||fwwnbucwoc.bid^$third-party
 ||fwxmscriszl.bid^$third-party
+||fwyofqdypydo.com^$third-party
 ||fwzlsugrflhh.com^$third-party
 ||fwzmxceibqmuvk.bid^$third-party
+||fwzqogrlgsdl.com^$third-party
+||fxazopwrns.com^$third-party
 ||fxcayktrneld.com^$third-party
+||fxdglnldbnyq.com^$third-party
+||fxfxpyrq.com^$third-party
 ||fxjgprpozntk.com^$third-party
 ||fxjyultd.com^$third-party
+||fxlmstfrxtqp.com^$third-party
 ||fxlyhuluw.com^$third-party
 ||fxoryjxrnuoo.com^$third-party
 ||fxpjkzwveswgtt.bid^$third-party
+||fxpqoyxlas.com^$third-party
 ||fxrgikipxnlq.com^$third-party
 ||fxsbodcjjmofm.bid^$third-party
 ||fxteikyi.bid^$third-party
 ||fxtgrttlarkl.com^$third-party
+||fxvbsnwnwoib.com^$third-party
 ||fxvxgwqcddvm.com^$third-party
 ||fxwkhwcmsqne.com^$third-party
+||fxwpmfdapcalu.com^$third-party
 ||fxzdwisjdihwj.bid^$third-party
+||fyaxvmnnfk.com^$third-party
 ||fyblldnlr.com^$third-party
 ||fybrwdikdsvzt.com^$third-party
 ||fyifssdoq.bid^$third-party
+||fynprrom.com^$third-party
 ||fypbjnwbuz.bid^$third-party
+||fyphnmoz.com^$third-party
+||fytrvzettfn.com^$third-party
 ||fyxuxfte.bid^$third-party
+||fyyyyppk.com^$third-party
+||fzbnuyjgyexs.com^$third-party
+||fzbyrntsjxhcmb.com^$third-party
+||fzccvcrsbtb.com^$third-party
 ||fzcgtfyn.bid^$third-party
 ||fzcgugzx.bid^$third-party
+||fzcyyqvrbrpk.com^$third-party
 ||fzhwvlpnqg.bid^$third-party
+||fzmogmfqh.com^$third-party
 ||fzpseyhkanhopd.com^$third-party
 ||fzqxefkbjzwiqa.com^$third-party
 ||fzrcalpbcu.com^$third-party
+||fzrqfakeaqikwm.com^$third-party
 ||fzsiwzxnqadb.com^$third-party
 ||fztrvkdqzv.bid^$third-party
+||fzwxuqoy.com^$third-party
 ||fzxraumht.bid^$third-party
+||fzyxygxa.com^$third-party
 ||fzzudxglrnrr.com^$third-party
 ||gaaprokoduuyyn.bid^$third-party
 ||gabyuyxwcubwdp.com^$third-party
 ||gafoswegc.com^$third-party
 ||gahhlbxdgw.com^$third-party
+||gaqhseuqp.com^$third-party
 ||gaxafjlxgoqfj.bid^$third-party
 ||gaxmdcfkxygs.com^$third-party
 ||gazogsjsoxty.com^$third-party
@@ -41317,68 +39497,101 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||gbnwjjxb.bid^$third-party
 ||gbsxcyukuuex.com^$third-party
 ||gbwgrhjjwz.com^$third-party
+||gbwhqbiiq.com^$third-party
 ||gbwrjyntqsvr.com^$third-party
 ||gbwzrcymfmvym.bid^$third-party
+||gbybvvfo.com^$third-party
+||gbytjlggor.com^$third-party
 ||gcboyhlfqxhc.com^$third-party
 ||gchfmrxxpfizw.bid^$third-party
 ||gcirwjlmyfgxm.bid^$third-party
+||gcpbftsiwdrajj.com^$third-party
 ||gcrqbzvwhz.bid^$third-party
 ||gcujnsgvdq.com^$third-party
 ||gcwhhynufwnj.com^$third-party
 ||gcxsbflncu.bid^$third-party
 ||gcypxlue.bid^$third-party
 ||gdbhmiyly.com^$third-party
+||gdbmpwlhf.com^$third-party
 ||gdbohhvoo.com^$third-party
+||gdczbvckwjafu.com^$third-party
 ||gdekvzhsqwau.com^$third-party
 ||gdhlysucwzyzu.com^$third-party
 ||gdhtshpyz.bid^$third-party
 ||gdixpvfqbhun.com^$third-party
 ||gdpuknsngvps.com^$third-party
+||gdskmueffp.com^$third-party
+||gdtbpaqa.com^$third-party
 ||gduubghr.bid^$third-party
+||gdwwpvwq.com^$third-party
+||gdyelbwku.com^$third-party
+||gdyjhclaxvqz.com^$third-party
 ||geazikjazoid.com^$third-party
+||gecxceztcnhkmh.com^$third-party
 ||gedmodsxbebd.com^$third-party
 ||gefaqjwdgzbo.com^$third-party
+||gekywqwky.com^$third-party
 ||genqrabot.com^$third-party
 ||geqcqduubhll.com^$third-party
 ||gerpkshe.com^$third-party
 ||geudyhlxmbj.bid^$third-party
 ||gevrsbmqvp.bid^$third-party
 ||gezkddgdbliip.bid^$third-party
+||gfamqlcmymxbeu.com^$third-party
+||gfchcxin.com^$third-party
 ||gfdeapuaymd.bid^$third-party
+||gfeaegaepsgp.com^$third-party
 ||gffupsrgds.com^$third-party
 ||gfhlwbxjjdla.bid^$third-party
 ||gfrlmvxfsvl.com^$third-party
+||gfuhjlpnuj.com^$third-party
+||gfyrxikptop.com^$third-party
 ||ggagqobykjh.com^$third-party
 ||ggbfbseakyqv.com^$third-party
+||ggezvffghs.com^$third-party
 ||gggemaop.com^$third-party
 ||gghepxqsga.com^$third-party
 ||gghhzzllakjm.bid^$third-party
+||ggijrjktcld.com^$third-party
 ||ggjsegnbriqhnz.com^$third-party
 ||ggnabmvnwphu.com^$third-party
 ||ggngbgccubvf.com^$third-party
+||ggntadmnwwm.com^$third-party
+||ggprfmbbl.com^$third-party
 ||ggrjihzgtdxutg.bid^$third-party
 ||ggscparljuz.com^$third-party
 ||ggtujtuyvcci.com^$third-party
 ||ggusxcee.bid^$third-party
+||gguvdsglzjyca.com^$third-party
 ||ggwbgnmahqyclg.com^$third-party
+||ggxvxrmrjitg.com^$third-party
 ||ggyrnhdbqxufh.com^$third-party
 ||ggzuksudqktn.com^$third-party
 ||ggzvlwrf.com^$third-party
 ||ghaszdguvrtnb.com^$third-party
 ||ghizipjlsi.bid^$third-party
+||ghjlhnbc.com^$third-party
 ||ghjwogfexch.com^$third-party
+||ghkajgexob.com^$third-party
+||ghkhvajwsiy.com^$third-party
+||ghomifuzhobtoo.com^$third-party
 ||ghtroafchzrt.com^$third-party
 ||ghttzqpeyunwdr.bid^$third-party
 ||ghycvwos.bid^$third-party
 ||ghygzvdh.bid^$third-party
+||ghytjserb.com^$third-party
 ||ghzylikrcdydf.bid^$third-party
+||gifjvmfkzykp.com^$third-party
 ||gigphdgtszus.bid^$third-party
 ||gigvyvqe.com^$third-party
+||giinmwnwsid.com^$third-party
 ||gimxqltq.bid^$third-party
 ||giojhiimnvwr.com^$third-party
 ||giphylee.com^$third-party
 ||gipmaxxp.bid^$third-party
 ||giqvmjiccwwys.bid^$third-party
+||girrjaqgjb.com^$third-party
+||gisiwdcqte.com^$third-party
 ||gitopazeaamdkm.bid^$third-party
 ||givmuvbacwui.com^$third-party
 ||giwvzhflxv.bid^$third-party
@@ -41387,19 +39600,32 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||gjbgesaromnb.com^$third-party
 ||gjeyqtunbnap.com^$third-party
 ||gjfugukpyo.bid^$third-party
+||gjijrevdp.com^$third-party
 ||gjikkwtrstaku.com^$third-party
 ||gjjsfchh.bid^$third-party
+||gjliurjvfnkymq.com^$third-party
+||gjmlseezqjy.com^$third-party
+||gjnusfiby.com^$third-party
+||gjriyqsfrnvuv.com^$third-party
+||gjrstyulnbf.com^$third-party
+||gjrzirxxkbw.com^$third-party
 ||gjvuxnfwsngmux.bid^$third-party
 ||gjwqxjqdvtldbh.bid^$third-party
 ||gjxdibyzvczd.com^$third-party
+||gjyfmlrqssyj.com^$third-party
+||gkaatcjxwa.com^$third-party
+||gkatquevzk.com^$third-party
 ||gkblyvnioxpd.com^$third-party
 ||gkcmxcbmcieykc.com^$third-party
 ||gkeahnmvduys.com^$third-party
 ||gkgdqahkcbmykurmngzrrolrecfqvsjgqdyujvgdrgoezkcobq.com^$third-party
+||gkhfahrtren.com^$third-party
 ||gkhubwgeber.bid^$third-party
+||gkhyhmtj.com^$third-party
 ||gkiqfnjtwmj.bid^$third-party
 ||gkiqlocbirh.com^$third-party
 ||gkiryieltcbg.com^$third-party
+||gkjtchmlj.com^$third-party
 ||gkkfirgzrfoxkx.com^$third-party
 ||gkmaclyrj.bid^$third-party
 ||gkrvjofbhdvo.bid^$third-party
@@ -41408,32 +39634,52 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||gkwdspzl.bid^$third-party
 ||gkyblmfggpyq.bid^$third-party
 ||glbgkmvl.com^$third-party
+||glbsuoebquueky.com^$third-party
 ||glcgytymbp.bid^$third-party
 ||glcpzwihisagw.bid^$third-party
+||glfiivzom.com^$third-party
 ||glfnjyzix.bid^$third-party
+||glfqztlzebamqw.com^$third-party
 ||glhbjwuovievay.bid^$third-party
 ||glhqdfmcchhk.bid^$third-party
 ||glhxoawgunlame.bid^$third-party
 ||gljanrsxz.com^$third-party
 ||gllkdkxygckb.com^$third-party
 ||glnqvqbedbmvtcdzcokrfczopbddhopygrvrnlgmalgvhnsfsc.com^$third-party
+||glpyiiahtdmaan.com^$third-party
 ||glslciwwvtxn.com^$third-party
+||gltpstgjnyb.com^$third-party
+||glvjbogft.com^$third-party
+||glvzlhrrdjlme.com^$third-party
 ||glyicpeke.com^$third-party
 ||glykvwol.bid^$third-party
+||glzaaewyvdkae.com^$third-party
+||gmcyfkrtw.com^$third-party
 ||gmecesfngrngu.bid^$third-party
+||gmeomlvmqlmu.com^$third-party
 ||gmfestfc.com^$third-party
+||gmjhwyby.com^$third-party
 ||gmnozoruyfy.bid^$third-party
 ||gmnxupczjmecj.bid^$third-party
+||gmowaloqmhtd.com^$third-party
 ||gmpdixdh.com^$third-party
 ||gmpmuqniggyz.com^$third-party
+||gmqczpcyzjeen.com^$third-party
+||gmquualzdmqtxp.com^$third-party
+||gmutfgxdvwmtf.com^$third-party
+||gmwqmjkggg.com^$third-party
+||gmxetthnzmqo.com^$third-party
+||gmzaaeenp.com^$third-party
 ||gnadhzstittd.com^$third-party
 ||gnaizrodp.com^$third-party
 ||gncfttutoiwwq.com^$third-party
 ||gniosksijt.bid^$third-party
 ||gnipadiiodpa.com^$third-party
+||gnkpuprxa.com^$third-party
 ||gnmjiishaldus.com^$third-party
 ||gnnmdzbroemx.com^$third-party
 ||gnqqajovkhfmq.com^$third-party
+||gnreqzzts.com^$third-party
 ||goacestnzgrd.com^$third-party
 ||gobijnwbyri.com^$third-party
 ||gobljmgamwfjrc.bid^$third-party
@@ -41443,19 +39689,28 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||gofsukrrqhcj.com^$third-party
 ||gogavdasjtxn.com^$third-party
 ||gogergyxl.com^$third-party
+||gogntrsm.com^$third-party
+||goiqwteaxvgc.com^$third-party
 ||gojotpbkyqou.bid^$third-party
 ||gojwyansqmcl.com^$third-party
+||golkkzpniri.com^$third-party
+||gonuuudpdcu.com^$third-party
 ||goowurzdotcom.bid^$third-party
+||goozbkcchscvb.com^$third-party
 ||gopamdzgpdrwe.bid^$third-party
+||gosrjadsh.com^$third-party
 ||gosvhpsc.com^$third-party
+||gouowkjmewn.com^$third-party
 ||gouytrujxuhkzk.bid^$third-party
 ||gozfsvoqn.com^$third-party
 ||gozmioancm.bid^$third-party
 ||gpacwxynxluey.bid^$third-party
 ||gpaeofyetjvff.bid^$third-party
+||gpatesbcesl.com^$third-party
 ||gpavxommrba.com^$third-party
 ||gpbznagpormpyusuxbvlpbuejqzwvspcyqjcxbqtbdtlixcgzp.com^$third-party
 ||gpdjgkibngbrr.com^$third-party
+||gpdqzmhayrcgsy.com^$third-party
 ||gperzgnvuuyx.com^$third-party
 ||gpgsxlmjnfid.com^$third-party
 ||gphfgyrkpumn.com^$third-party
@@ -41470,11 +39725,22 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||gptafybrj.com^$third-party
 ||gptkueuaseyut.com^$third-party
 ||gptoleeekac.bid^$third-party
+||gpudqmly.com^$third-party
+||gpuulhuupfinoq.com^$third-party
+||gpzywrsrcr.com^$third-party
+||gqekfxgdaxoau.com^$third-party
+||gqlaoeyczxsvk.com^$third-party
+||gqlmavnoavcaw.com^$third-party
 ||gqlqgmiahdtoyl.bid^$third-party
 ||gqmrdezduagsqi.com^$third-party
 ||gqnmautydwky.com^$third-party
 ||gqnotcpintcq.bid^$third-party
 ||gqorytmpkjdq.com^$third-party
+||gqosdcpjxajae.com^$third-party
+||gqqsqbipuhlzb.com^$third-party
+||gqrsxfwxvx.com^$third-party
+||gqrwjsjbnoayff.com^$third-party
+||gqrxsjqo.com^$third-party
 ||gqtaibrlhbwd.bid^$third-party
 ||gqtcapjnn.bid^$third-party
 ||gqthfroeirol.com^$third-party
@@ -41486,32 +39752,49 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||grceweaxhbpvclyxhwuozrbtvqzjgbnzklvxdezzficwjnmfil.com^$third-party
 ||grewuxii.bid^$third-party
 ||grfqrhqlzvjl.com^$third-party
+||grgxptjsgl.com^$third-party
 ||grhqitjkih.bid^$third-party
+||grkrkurbyykok.com^$third-party
 ||grlehzdbzmstb.com^$third-party
+||grlygpybnhbwcu.com^$third-party
 ||grnrmwxf.com^$third-party
 ||grppxsxgcdcu.bid^$third-party
 ||grrduoonwjpy.com^$third-party
+||grsdvgnr.com^$third-party
+||grsnseuoispsco.com^$third-party
+||grtbzrsndrrtsb.com^$third-party
 ||grtduutw.bid^$third-party
 ||grubpbrmek.com^$third-party
 ||grvoflsctenq.bid^$third-party
 ||grxpaizsvdzw.com^$third-party
 ||gsfvzgnu.com^$third-party
+||gsghbxydcyum.com^$third-party
 ||gshiupcdkolv.bid^$third-party
 ||gsiqerorqkxu.com^$third-party
+||gsjhehtqvin.com^$third-party
 ||gsqhqbaysfmp.bid^$third-party
 ||gsqwxrtcabdftt.com^$third-party
 ||gstpgbhqzia.bid^$third-party
 ||gsueoeigaq.com^$third-party
+||gswaelxxh.com^$third-party
 ||gsxehyapoafiwe.com^$third-party
 ||gsxewjrbrbtldy.com^$third-party
 ||gsxvgomvbfrj.com^$third-party
 ||gtaouarrwypu.com^$third-party
 ||gtbfhyprjhqz.com^$third-party
+||gtbrnqncz.com^$third-party
+||gtcjcqxpgykuq.com^$third-party
 ||gtcpsbvtwaqw.com^$third-party
 ||gtevyaeeiged.com^$third-party
 ||gtfbvxlmev.com^$third-party
 ||gthrdhxhwdt.bid^$third-party
+||gtjpkitasq.com^$third-party
+||gtkikiwa.com^$third-party
+||gtlcgovlg.com^$third-party
 ||gtmonytxxglu.com^$third-party
+||gtnlyyxfhkjv.com^$third-party
+||gtnmyddlf.com^$third-party
+||gtorsoxdh.com^$third-party
 ||gtqfsxrrerzu.com^$third-party
 ||gttrngwnuuvy.bid^$third-party
 ||gtvnygwfzrhfti.com^$third-party
@@ -41519,80 +39802,121 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||gtzyfaro.bid^$third-party
 ||gubdadtxwqow.com^$third-party
 ||gubisowidb.com^$third-party
+||gudlhvxz.com^$third-party
 ||gufjfwopsez.bid^$third-party
+||gugemfslzh.com^$third-party
+||guhpyglt.com^$third-party
 ||guhtjoqtobac.com^$third-party
 ||gujyvlvoewweg.bid^$third-party
 ||gulvkhfah.bid^$third-party
+||gumdeqjzclc.com^$third-party
 ||guoijslfm.bid^$third-party
 ||guowsqbyh.bid^$third-party
+||guoyhfjrpt.com^$third-party
 ||gurrfwsscwda.com^$third-party
+||gusxyrtlnyv.com^$third-party
+||gutccaxnwso.com^$third-party
 ||guwegqmvqxfa.bid^$third-party
 ||guziwptcqucio.bid^$third-party
+||guzqqzsv.com^$third-party
 ||guzwqarqdxai.bid^$third-party
+||gvahzhgblkkyr.com^$third-party
 ||gvbeqaethxhs.bid^$third-party
+||gvdjqwahgh.com^$third-party
 ||gverjfuapaag.com^$third-party
 ||gvfubsvgdodrj.com^$third-party
 ||gvgakxvukmrm.com^$third-party
+||gvhqnlti.com^$third-party
 ||gvlhdacnu.bid^$third-party
 ||gvmbrwlqqwa.bid^$third-party
+||gvoraoonpi.com^$third-party
 ||gvoszbzfzmtl.com^$third-party
 ||gvrqquiotcyr.com^$third-party
 ||gvsvegtnsyoxt.bid^$third-party
+||gvwyxnyq.com^$third-party
 ||gvxobjcxcbkb.com^$third-party
 ||gvyliqny.bid^$third-party
+||gvzphwswtv.com^$third-party
 ||gwaatiev.com^$third-party
 ||gwasavfgelbuah.bid^$third-party
 ||gwcujaprdsen.com^$third-party
+||gwohimtyhbthg.com^$third-party
+||gwovohvkzay.com^$third-party
 ||gwqkliacsn.bid^$third-party
 ||gwquuagkjxbq.com^$third-party
 ||gwsomeiyywaz.com^$third-party
+||gwxaulcgmizcq.com^$third-party
 ||gxdyluyqciac.com^$third-party
+||gxeoadmo.com^$third-party
 ||gxfzlnwlizmur.com^$third-party
 ||gxgnvickedxpuiavkgpisnlsphrcyyvkgtordatszlrspkgppe.com^$third-party
 ||gxgtmttcaofiq.com^$third-party
+||gxklbrtpqqyvy.com^$third-party
 ||gxkwwbqzsg.com^$third-party
+||gxleeixyzlaaab.com^$third-party
 ||gxluqcpsfhc.bid^$third-party
 ||gxmpahyt.bid^$third-party
 ||gxordgtvjr.com^$third-party
+||gxpijskyqwqfjw.com^$third-party
+||gxptetvbtkfj.com^$third-party
 ||gxqjoqpkexn.bid^$third-party
+||gxqocoxl.com^$third-party
+||gxqotelkdra.com^$third-party
 ||gxqrjjcsyh.com^$third-party
 ||gxuibhjxssnrol.bid^$third-party
 ||gxvbogvbcivs.com^$third-party
 ||gxwjkbxubfjd.com^$third-party
+||gxxkrzrvy.com^$third-party
 ||gxxsqeqlepva.com^$third-party
+||gxzfpusmd.com^$third-party
 ||gyahidmf.bid^$third-party
 ||gydfsypjiaymj.com^$third-party
 ||gydlzimosfnz.com^$third-party
 ||gyhujxbptum.com^$third-party
 ||gyinmxpztbgf.com^$third-party
 ||gynhbuspeiud.bid^$third-party
+||gynzvwhup.com^$third-party
 ||gyojplgn.com^$third-party
 ||gypxbcrmxsmikqbmnlwtezmjotrrdxpqtafumympsdtsfvkkza.com^$third-party
 ||gyvyokpmmb.bid^$third-party
+||gyycgkchjtimu.com^$third-party
 ||gyzzpyez.bid^$third-party
 ||gzakmhhwrkagg.com^$third-party
 ||gzhazcfkr.bid^$third-party
 ||gziedzbliamx.com^$third-party
 ||gzkoehgbpozz.com^$third-party
+||gzmknnasowdtop.com^$third-party
 ||gzmofmqddajr.com^$third-party
+||gzoprhvqhie.com^$third-party
 ||gzozvhryjcf.com^$third-party
 ||gzpqlbqyerpb.com^$third-party
 ||gzqccijroe.bid^$third-party
+||gzqoxmkuhl.com^$third-party
 ||gzrlatbooqmt.com^$third-party
 ||gzumjmvqjkki.com^$third-party
+||gzuvyhqb.com^$third-party
 ||gzxjfkhwvhwfzr.com^$third-party
 ||gzyddiyiyme.bid^$third-party
 ||gzzctcekf.com^$third-party
 ||haezawhdumz.bid^$third-party
 ||hafbezbemwwd.com^$third-party
+||hafksvqiir.com^$third-party
+||hagiqxizxqf.com^$third-party
 ||hajcehcnodio.com^$third-party
 ||hajnoqtsfg.com^$third-party
 ||hajsefgocgkxfg.com^$third-party
 ||hajtekzuoe.com^$third-party
+||hamjgkzgycmur.com^$third-party
+||hanimyel.com^$third-party
 ||hanwlgpecblxf.bid^$third-party
+||haqbllmvpbqc.com^$third-party
 ||haqlmmii.com^$third-party
+||hasrijwnxtn.com^$third-party
 ||hasxepvkld.com^$third-party
 ||hattifkklbo.bid^$third-party
+||hauvkkwrbme.com^$third-party
+||hayxktgbqpmult.com^$third-party
+||hbbgrhzqezz.com^$third-party
 ||hbbwlhxfnbpq.com^$third-party
 ||hbbxkbjhiiue.bid^$third-party
 ||hbchwmrqb.bid^$third-party
@@ -41600,34 +39924,58 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||hbedvoyluzmq.com^$third-party
 ||hbfnmcncnasfb.bid^$third-party
 ||hbguvcwi.com^$third-party
+||hbhcilgdqxt.com^$third-party
 ||hbhcndcpohpwib.com^$third-party
 ||hbhjamkcubtez.com^$third-party
+||hbkajyvrus.com^$third-party
 ||hbkcelqibvx.bid^$third-party
+||hbnqcbfgsjfa.com^$third-party
 ||hbrbtmjyvdsy.com^$third-party
 ||hbrsqluft.bid^$third-party
 ||hbrvwrdama.bid^$third-party
 ||hbvhahzjh.bid^$third-party
 ||hbvnnwtoonhh.com^$third-party
+||hbycvbyyj.com^$third-party
 ||hbzfhzpd.bid^$third-party
 ||hbzzkwsuaooc.com^$third-party
 ||hcbntenhgaq.bid^$third-party
 ||hcggkyhzxzsv.com^$third-party
+||hcijbbzz.com^$third-party
 ||hckmbeebnstnp.bid^$third-party
 ||hclccadfmkpw.com^$third-party
+||hcmafnawzxfnam.com^$third-party
+||hcmjlsxhebb.com^$third-party
+||hcqjgkpg.com^$third-party
 ||hcrsxbke.com^$third-party
 ||hctcdmqp.com^$third-party
+||hcwdcintgl.com^$third-party
+||hcycanmscyg.com^$third-party
+||hcyqwhquqjosn.com^$third-party
 ||hcyxksgsxnzb.com^$third-party
+||hdcfyrzx.com^$third-party
 ||hddgigiwip.bid^$third-party
+||hddzzizitskc.com^$third-party
 ||hdeiyrdw.bid^$third-party
+||hdfsruiqwgjdo.com^$third-party
 ||hdimfhptnjgm.bid^$third-party
 ||hdmxceunntsy.bid^$third-party
+||hdnvtfyvyhq.com^$third-party
+||hdoabbjyyebca.com^$third-party
+||hduefoyd.com^$third-party
 ||hdweefzvb.bid^$third-party
+||hdwjwooqvnm.com^$third-party
+||hdwkcfqzxhvx.com^$third-party
 ||hdwlzheftpin.com^$third-party
 ||hdxeyqvfb.bid^$third-party
+||hdxfyoziizy.com^$third-party
+||heaaizwhm.com^$third-party
 ||heawnqbmsi.bid^$third-party
 ||heefwozhlxgz.com^$third-party
+||hefgfqcyfmv.com^$third-party
 ||hefgynqlzwi.com^$third-party
+||hehraybryciyls.com^$third-party
 ||heikwwkqy.com^$third-party
+||heinvugrgkcxl.com^$third-party
 ||henodmetgjbsas.bid^$third-party
 ||hepuzqrx.com^$third-party
 ||heqcvweqvqf.com^$third-party
@@ -41636,8 +39984,11 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||hevdxhsfbwud.com^$third-party
 ||hevfziuvxq.bid^$third-party
 ||heydqkfbglbu.com^$third-party
+||hezasoiduicbha.com^$third-party
 ||hfbnztgnmheyd.bid^$third-party
 ||hfcczxpyfdhl.bid^$third-party
+||hfedqcww.com^$third-party
+||hffgptqfpewjz.com^$third-party
 ||hffmxndinqyo.com^$third-party
 ||hffmzplu.com^$third-party
 ||hffqgxgjiqdlx.bid^$third-party
@@ -41645,146 +39996,235 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||hfhhijsewsqn.com^$third-party
 ||hfjuehls.com^$third-party
 ||hfmtqgiqscvg.com^$third-party
+||hfnxxzotprja.com^$third-party
+||hfslmsbj.com^$third-party
 ||hftyrwqjknhzoa.com^$third-party
+||hfubvezyoyqs.com^$third-party
+||hfydxmahpllyx.com^$third-party
 ||hfyqolbetdprw.bid^$third-party
 ||hfzikiht.com^$third-party
 ||hgbmwkklwittcdkjapnpeikxojivfhgszbxmrjfrvajzhzhuks.com^$third-party
+||hgbxmqyqoplpif.com^$third-party
 ||hgcgfxjkvjch.com^$third-party
+||hgdmzshm.com^$third-party
 ||hgdovdnd.com^$third-party
 ||hgezwkouu.bid^$third-party
 ||hgfgzqwbjnebd.com^$third-party
 ||hgirriqj.bid^$third-party
+||hgowmgat.com^$third-party
 ||hgqmkbpvmyn.bid^$third-party
+||hgukeujwsfgwrq.com^$third-party
 ||hgzopbyhidre.com^$third-party
 ||hgztvnjbsrki.com^$third-party
 ||hhdbbixxs.bid^$third-party
+||hheeffxjz.com^$third-party
+||hhffiibyamkvyu.com^$third-party
 ||hhfgemuvmyq.com^$third-party
 ||hhghlgxioqjefi.com^$third-party
 ||hhiprhclh.com^$third-party
+||hhleomgyiruth.com^$third-party
+||hhlrnfmn.com^$third-party
 ||hhnamywutsvovm.bid^$third-party
 ||hhnvtfiiitzf.bid^$third-party
+||hhrxmgaepe.com^$third-party
 ||hhshbknewaikmj.bid^$third-party
 ||hhwqfmqyqoks.com^$third-party
 ||hhzqedgjajvi.com^$third-party
 ||hibiaygg.com^$third-party
 ||hibtgsibarfg.bid^$third-party
+||higishzxn.com^$third-party
 ||higrbwtxkjuw.com^$third-party
 ||higygtvnzxad.com^$third-party
 ||hihyunxtiuqhhm.bid^$third-party
+||hiitwzyvkdyvxn.com^$third-party
 ||hijvwwbnbhb.bid^$third-party
 ||hilkfxdqxzac.com^$third-party
 ||hiltrkavduozt.com^$third-party
 ||hirdchyngnn.bid^$third-party
+||hisxgmthxjdm.com^$third-party
 ||hixuxtufzqcq.com^$third-party
 ||hiypucxjvfka.com^$third-party
+||hjbfpopj.com^$third-party
 ||hjeoncuvklqh.com^$third-party
+||hjgmasrve.com^$third-party
+||hjihwmtsltqi.com^$third-party
+||hjjdmohuzp.com^$third-party
+||hjjjsurdhtt.com^$third-party
+||hjknszojbbecy.com^$third-party
+||hjnekvux.com^$third-party
 ||hjnfurphlwsui.bid^$third-party
 ||hjopehvzspngi.com^$third-party
 ||hjtgpkwppx.bid^$third-party
 ||hjtoguxtzkl.bid^$third-party
 ||hjukmfdbryln.com^$third-party
 ||hjvdkrjmxngg.com^$third-party
+||hjxrhlmei.com^$third-party
+||hjyhfusvr.com^$third-party
 ||hjyxnjfbrj.bid^$third-party
 ||hkacgxlpfurb.com^$third-party
 ||hkdjrnkjwtqo.com^$third-party
+||hkhotpewfxr.com^$third-party
+||hkjxihngzlmwc.com^$third-party
 ||hklyzmspvqjh.com^$third-party
+||hknuifygfbz.com^$third-party
 ||hkoxlirf.com^$third-party
+||hkoxznukwpdhxu.com^$third-party
+||hkqhuilqnu.com^$third-party
 ||hksmitcmlo.bid^$third-party
 ||hkurphzwv.bid^$third-party
 ||hkvqwkeyruvy.bid^$third-party
 ||hkvqyjtdghbe.com^$third-party
+||hkwzswzf.com^$third-party
 ||hkyskqpsqwjq.bid^$third-party
 ||hkyykkerrp.com^$third-party
+||hldsogaxfq.com^$third-party
 ||hlekbinpgsuk.com^$third-party
 ||hlgodnojfffhpc.bid^$third-party
 ||hlicmukjz.bid^$third-party
 ||hljiofrtqenc.com^$third-party
 ||hljyawylquvl.bid^$third-party
 ||hlotiwnz.com^$third-party
+||hloyloppqpvnmd.com^$third-party
 ||hlqnhatfxtclut.com^$third-party
+||hlrziwaldlui.com^$third-party
+||hlsqjrgeuw.com^$third-party
+||hlvvlouaeicp.com^$third-party
+||hlvzvisiwbtuwv.com^$third-party
+||hmbgumjgey.com^$third-party
 ||hmcczsoimnjxzi.com^$third-party
 ||hmcjupvbxxyx.com^$third-party
 ||hmdmvaxmmwoso.bid^$third-party
 ||hmeojqyjoascs.com^$third-party
+||hmepgymo.com^$third-party
+||hmgozryqbc.com^$third-party
 ||hmjkyzdmoxp.com^$third-party
 ||hmjtutipevtmg.com^$third-party
 ||hmkrfmtra.bid^$third-party
 ||hmlghvujrve.com^$third-party
+||hmmmcjgho.com^$third-party
 ||hmqzghfpl.bid^$third-party
 ||hmwsaxnhc.com^$third-party
 ||hmwxaldhioby.bid^$third-party
 ||hmypgdhzd.com^$third-party
+||hmzwcomigpqia.com^$third-party
 ||hndesrzcgjmprqbbropdulvkfroonnrlbpqxhvprsavhwrfxtv.com^$third-party
 ||hngjhdhdkkfbcz.bid^$third-party
 ||hnhfengrgk.bid^$third-party
+||hnhsvlswqtoxgn.com^$third-party
 ||hnitbiubtg.bid^$third-party
 ||hnivikwwypcv.com^$third-party
 ||hnkbivnten.com^$third-party
+||hnntopkvrsivwc.com^$third-party
 ||hnoajsaivjsg.com^$third-party
 ||hnopgrab.com^$third-party
 ||hnqnftzzytjl.com^$third-party
+||hnregzjxsafu.com^$third-party
+||hnsamgkrtliye.com^$third-party
+||hnshjxowpldar.com^$third-party
+||hntntnfizowo.com^$third-party
 ||hntpbpeiuajc.com^$third-party
+||hntxitqhto.com^$third-party
 ||hnuhqaslqaqtb.bid^$third-party
 ||hnvbfamkwmq.bid^$third-party
 ||hnztceqkabwm.bid^$third-party
 ||hobjzsymztzk.com^$third-party
 ||hobtkxap.com^$third-party
 ||hodhrwizh.bid^$third-party
+||hoghqjddg.com^$third-party
+||hogylomirfc.com^$third-party
 ||hohfiknuk.com^$third-party
+||hohrnldconk.com^$third-party
 ||hokehntutt.bid^$third-party
 ||hopafrmwpckj.com^$third-party
+||hoqqzlvwukpo.com^$third-party
 ||horylaht.bid^$third-party
 ||hosiioyx.com^$third-party
 ||hosqkmnjt.com^$third-party
 ||hotdzbtmngof.bid^$third-party
 ||howjkpaynzwf.com^$third-party
+||hoyqhygv.com^$third-party
 ||hoytzfyok.bid^$third-party
 ||hpabkunldxhpc.com^$third-party
+||hpbczauldndnep.com^$third-party
+||hpbsyqsypxy.com^$third-party
 ||hpcniufqp.bid^$third-party
 ||hpdmnmehzcor.com^$third-party
+||hpkkzzyek.com^$third-party
 ||hpkwirncwvxo.com^$third-party
 ||hplgpoicsnea.com^$third-party
 ||hpltfwbm.com^$third-party
 ||hpmgdwvvqulp.com^$third-party
 ||hpnthbgdv.bid^$third-party
 ||hpqxznpb.bid^$third-party
+||hpsthxyqxqae.com^$third-party
+||hpufwccrmiwz.com^$third-party
 ||hpvxmmttf.bid^$third-party
+||hpwsosviqyjem.com^$third-party
+||hpxbifcd.com^$third-party
 ||hpxxzfzdocinivvulcujuhypyrniicjfauortalmjerubjgaja.com^$third-party
 ||hpyqmmaxjrt.bid^$third-party
+||hpyxckmwle.com^$third-party
 ||hpzpjalq.bid^$third-party
 ||hqaajpaedpux.com^$third-party
+||hqbphxpavrxry.com^$third-party
+||hqgenotbptcu.com^$third-party
 ||hqkoismxnocd.com^$third-party
+||hqkwnyub.com^$third-party
 ||hqncduqyzgfugo.com^$third-party
 ||hqnyahlpmehp.com^$third-party
+||hqqyesittgihp.com^$third-party
+||hqsgnzvjkyog.com^$third-party
 ||hqsxomhxwhpq.com^$third-party
+||hqtlbsglscrju.com^$third-party
 ||hqtrxzcjjjj.com^$third-party
+||hqtvvfqmfykcrs.com^$third-party
 ||hquijlndtd.com^$third-party
+||hqupjfmq.com^$third-party
+||hqwlpexoywbc.com^$third-party
 ||hqxtsqwpvort.com^$third-party
+||hqyenmzgxk.com^$third-party
+||hraowdzgs.com^$third-party
+||hrarjpeqtcsge.com^$third-party
+||hrcqeghr.com^$third-party
 ||hrdbamvfzipe.com^$third-party
 ||hrfbfuxksimzi.bid^$third-party
 ||hrkshoveizfo.com^$third-party
+||hrmqqrvqaxvzb.com^$third-party
+||hrorxufknjdm.com^$third-party
 ||hrskwmpvpgocj.com^$third-party
 ||hrtgkdwjbjblb.com^$third-party
+||hrtxufdb.com^$third-party
 ||hrvxpinmdyjx.com^$third-party
 ||hrykyhqtgcro.com^$third-party
 ||hsdjvuayagt.bid^$third-party
 ||hseyrxoi.com^$third-party
+||hsgatgymg.com^$third-party
 ||hshbyyuh.bid^$third-party
 ||hsivniaui.bid^$third-party
 ||hsllwumsezanll.com^$third-party
 ||hsnuutxbmmqry.bid^$third-party
 ||hsnvnmjriom.com^$third-party
 ||hsoyrqqsludd.com^$third-party
+||hsqslxewsnga.com^$third-party
+||hsqvofrzwluvns.com^$third-party
+||hstqqjxqwnrfhy.com^$third-party
+||hsufwxpdtddlh.com^$third-party
 ||hsuohkuegd.bid^$third-party
 ||hsvqfvjidloc.com^$third-party
+||hsxftwpltcmil.com^$third-party
+||hsydzoapohcvbz.com^$third-party
 ||hsyjdpgetl.bid^$third-party
 ||hszyozoawqnk.com^$third-party
 ||htabtzmi.bid^$third-party
+||htegogwj.com^$third-party
 ||hteysvcuzycp.bid^$third-party
+||htgpsnbtha.com^$third-party
 ||hthrytimx.bid^$third-party
 ||htkoyuyk.bid^$third-party
 ||htldvsrwwx.bid^$third-party
 ||htllanmhrnjrbestmyabzhyweaccazvuslvadtvutfiqnjyavg.com^$third-party
+||htlvvqlcqvq.com^$third-party
+||htmvtmglofpbz.com^$third-party
 ||htnzwuvgphjwqc.bid^$third-party
 ||htonrwegnifw.com^$third-party
 ||htpkxpgbprpklc.com^$third-party
@@ -41799,6 +40239,8 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||huejizictcgd.com^$third-party
 ||huewmezzodzdv.com^$third-party
 ||hufaymllqce.club^$third-party
+||hugjupzdpvuzdr.com^$third-party
+||huhrxmgiofzna.com^$third-party
 ||huigyetqu.com^$third-party
 ||humcyddkxxm.bid^$third-party
 ||hunktnva.com^$third-party
@@ -41815,22 +40257,34 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||hvccjhkcvlfr.com^$third-party
 ||hvckvfistbejp.com^$third-party
 ||hvdddlsdexic.com^$third-party
+||hvdyyojh.com^$third-party
 ||hvfjefgtjdh.bid^$third-party
 ||hvfolkwvgjgc.com^$third-party
 ||hvftzxkepauct.bid^$third-party
 ||hvfzacisynoq.com^$third-party
 ||hvfzshrpfueb.com^$third-party
+||hvgytlbdnuqunp.com^$third-party
+||hvitcycze.com^$third-party
 ||hvmimwpe.com^$third-party
 ||hvnkfjywxojrwo.bid^$third-party
+||hvpcxythnjl.com^$third-party
+||hvqqergvbpvetq.com^$third-party
 ||hvukouhckryjudrawwylpboxdsonxhacpodmxvbonqipalsprb.com^$third-party
+||hvulkudamh.com^$third-party
 ||hvuvqsun.com^$third-party
 ||hvvhxzdps.com^$third-party
 ||hvvxxszxslome.bid^$third-party
 ||hvwagkmgef.com^$third-party
+||hvwaieuielzzy.com^$third-party
 ||hwcgnavycq.com^$third-party
 ||hwfcdqnvovij.com^$third-party
+||hwhdxuid.com^$third-party
+||hwhzonbib.com^$third-party
+||hwiccseamrs.com^$third-party
+||hwjjxzzbpbn.com^$third-party
 ||hwktxvrvz.bid^$third-party
 ||hwkxtltut.bid^$third-party
+||hwlykqjlytnm.com^$third-party
 ||hwmgcurmtkxk.bid^$third-party
 ||hwongtcmnhpxd.bid^$third-party
 ||hwoqbjouvfn.bid^$third-party
@@ -41843,54 +40297,82 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||hxbvbmxv.com^$third-party
 ||hxcoxdyzzd.com^$third-party
 ||hxhabfjy.bid^$third-party
+||hxhxjcffzp.com^$third-party
+||hxhyejtblmu.com^$third-party
 ||hxkanryhktub.com^$third-party
 ||hxlkmsib.bid^$third-party
 ||hxlojjtpqtlk.com^$third-party
 ||hxqdddqnuqcwe.com^$third-party
+||hxqetblh.com^$third-party
+||hxqhctdtdsr.com^$third-party
 ||hxrsjlqnep.com^$third-party
 ||hxsfrcdrrp.com^$third-party
 ||hxuasnwokh.com^$third-party
 ||hxuvwqsecumg.com^$third-party
 ||hxvbrahd.bid^$third-party
 ||hxvdrelj.bid^$third-party
+||hxvuuswzydwykb.com^$third-party
 ||hxwxxhfydbifuq.com^$third-party
 ||hyexdezezjqw.bid^$third-party
 ||hyhabjqndvwf.bid^$third-party
 ||hymandywo.com^$third-party
+||hyrnujewyatvd.com^$third-party
+||hysnqwbokyuvsm.com^$third-party
+||hysyqgbls.com^$third-party
 ||hytkatubjuln.com^$third-party
 ||hyubowucvkch.com^$third-party
+||hyurzuxoksg.com^$third-party
 ||hyvsquazvafrmmmcfpqkabocwpjuabojycniphsmwyhizxgebu.com^$third-party
 ||hywwsavdydy.bid^$third-party
 ||hyxhxnlqeppn.com^$third-party
 ||hyzncftkveum.com^$third-party
 ||hzivfezfltago.com^$third-party
 ||hzskbnafzwsu.com^$third-party
+||hztjenzlrrwinq.com^$third-party
 ||hztkbjdkaiwt.com^$third-party
 ||hzulgipdcbgwad.com^$third-party
+||hzwmcqlmxpdrlp.com^$third-party
 ||hzwxkqnqrdfv.com^$third-party
 ||hzxtamstwecry.bid^$third-party
 ||hzyvjghy.bid^$third-party
 ||hzyxaqdr.bid^$third-party
+||iaatzkkqyv.com^$third-party
+||iacexhglty.com^$third-party
+||iadfjbrttvgn.com^$third-party
+||iafqqcsw.com^$third-party
 ||iagsqudxpcfr.com^$third-party
 ||iagvkdeienla.com^$third-party
 ||iaimnsxepxdy.bid^$third-party
 ||iansucrovvzbi.bid^$third-party
 ||iaoisfnac.com^$third-party
 ||iaoyikwmocuvr.com^$third-party
+||iapxxrjzc.com^$third-party
+||iasodjsbjcq.com^$third-party
+||iatwyqgvpq.com^$third-party
 ||iauvabogtws.bid^$third-party
 ||iaxxhqwaig.com^$third-party
+||ibclxtlh.com^$third-party
+||ibcnwhnbid.com^$third-party
+||ibetinwubwl.com^$third-party
 ||ibeyqnjfjgsuob.bid^$third-party
+||ibfsream.com^$third-party
+||ibfueyttemsefi.com^$third-party
 ||ibjtuhcgwnamyf.com^$third-party
 ||ibkfummkqzlg.com^$third-party
 ||ibljirpmxvav.bid^$third-party
+||ibnuoduab.com^$third-party
 ||ibojmmgjto.bid^$third-party
 ||ibqmccuuhjqc.com^$third-party
 ||ibycicwahzg.com^$third-party
 ||icafyriewzzrwxlxhtoeakmwroueywnwhmqmaxsqdntasgfvhc.com^$third-party
+||icahllwjc.com^$third-party
 ||icdkqyeydxpjmw.com^$third-party
+||icfjzmqsejzfb.com^$third-party
+||icfxndxwpan.com^$third-party
 ||icgakpprechm.com^$third-party
 ||icjeqbqdzhyx.com^$third-party
 ||icjniokadnrqht.com^$third-party
+||icjpdubxgab.com^$third-party
 ||icjurmxhqpdpbt.bid^$third-party
 ||iclbkrgjdstqt.com^$third-party
 ||icltessfskwle.bid^$third-party
@@ -41898,49 +40380,82 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||icpfrrffsenr.com^$third-party
 ||icqvwlelvzldh.bid^$third-party
 ||icrnyafg.bid^$third-party
+||ictmdbus.com^$third-party
+||icuazeczpeoohx.com^$third-party
 ||icxssspyxquw.bid^$third-party
 ||icyddcsjbqjxz.bid^$third-party
 ||icyfqtjj.bid^$third-party
 ||iczhhiiowapd.com^$third-party
+||idbjhskxiablsi.com^$third-party
+||idbpftjjz.com^$third-party
+||idbtfwllhogxc.com^$third-party
 ||idbxnzgmn.com^$third-party
 ||idcoyhwzthhjv.com^$third-party
+||iddvmkxme.com^$third-party
 ||idejenmqxhy.bid^$third-party
 ||idelmxrchrce.com^$third-party
+||ideprjebdvj.com^$third-party
+||idernzastoeok.com^$third-party
 ||idfybbol.com^$third-party
+||idissynmirkw.com^$third-party
 ||idiyejpux.bid^$third-party
 ||idkyfrsbzesx.com^$third-party
 ||idopjddmtzo.bid^$third-party
 ||idpukwmp.com^$third-party
 ||idqsygpvizjp.bid^$third-party
+||idqzpnea.com^$third-party
+||idrdmyixk.com^$third-party
+||idszrbmjvkdodt.com^$third-party
 ||idvuakamkzmx.com^$third-party
+||idxrjpfxrqernb.com^$third-party
 ||ieajwbir.com^$third-party
 ||ieavcqhxtpak.com^$third-party
 ||iebnsqfwfhl.bid^$third-party
 ||iectshrhpgsl.com^$third-party
+||iedijlgkbqc.com^$third-party
 ||ieeawxjool.com^$third-party
 ||iekztyhqfs.bid^$third-party
 ||ielqcwzwjczpx.bid^$third-party
 ||ieoexdjxrwtq.com^$third-party
+||ieqbsnteuyn.com^$third-party
 ||ieqprskfariw.com^$third-party
+||ierhqysqwrziez.com^$third-party
 ||ieuezabolxphga.com^$third-party
 ||iewsaprgerkjny.com^$third-party
 ||ifaklabnhplb.com^$third-party
+||ifbhceoxx.com^$third-party
+||ifdmdfqysaacqa.com^$third-party
+||ifecuwzjajkiq.com^$third-party
+||ifeuddaywa.com^$third-party
+||iffzxqnhd.com^$third-party
+||ifgnsrtjcz.com^$third-party
+||iflndvke.com^$third-party
 ||ifmobkrjonnm.com^$third-party
+||ifofucuvklrnfw.com^$third-party
+||ifoldmuxqjeddk.com^$third-party
+||ifqzzgwrra.com^$third-party
 ||iftvlrkyvubnn.com^$third-party
+||ifuvjvbyjir.com^$third-party
 ||ifvetqzfiawg.com^$third-party
 ||ifvgsekkvcc.bid^$third-party
 ||ifyngpctovtv.com^$third-party
 ||igawfxfnupeb.com^$third-party
+||igbznxar.com^$third-party
 ||igdfzixkdzxe.com^$third-party
 ||igfuvwscradtpu.bid^$third-party
+||iggukjfuylwyv.com^$third-party
+||ighavizixlohvi.com^$third-party
 ||igifhnkw.com^$third-party
 ||iglwibwbjxuoflrczfvpibhihwuqneyvmhzeqbmdmujmirdkae.com^$third-party
+||igsxvpghnamnsz.com^$third-party
 ||igupodzh.com^$third-party
 ||igutgembqnw.bid^$third-party
 ||igvcpjsyk.bid^$third-party
 ||igwzuwwtvnywx.com^$third-party
+||igycquuoypdiqx.com^$third-party
 ||igyzmhqbihoi.com^$third-party
 ||ihcamesgexiv.com^$third-party
+||ihcbfiqkp.com^$third-party
 ||ihdrozswbekx.com^$third-party
 ||ihfktkrasg.bid^$third-party
 ||ihflwxrsptqz.com^$third-party
@@ -41951,20 +40466,34 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||ihqxhokndcfq.com^$third-party
 ||ihriduffgkel.com^$third-party
 ||ihtatthazitg.bid^$third-party
+||ihvmcqojoj.com^$third-party
 ||ihzdrktzyrzq.bid^$third-party
+||ihzyxuhgocszv.com^$third-party
 ||iialqejeka.com^$third-party
 ||iibcejrrfhxh.com^$third-party
 ||iiblzgczrrdiqf.bid^$third-party
+||iiccrpwaxmxkqm.com^$third-party
 ||iihwyqhxajtn.com^$third-party
 ||iijmodcvlwfk.com^$third-party
 ||iikhhkwryiqq.bid^$third-party
+||iilrgkor.com^$third-party
+||iimueeipaitpb.com^$third-party
 ||iinkhwsh.bid^$third-party
 ||iipivevueme.com^$third-party
 ||iipkiyju.bid^$third-party
 ||iisfpzkkxkz.com^$third-party
 ||iitfqholnpud.com^$third-party
+||iizgpusp.com^$third-party
 ||ijbybfznp.com^$third-party
 ||ijeuhlrqznjb.com^$third-party
+||ijfnbtksuntwqe.com^$third-party
+||ijhpzjzjaujpov.com^$third-party
+||ijhqzvlnsxu.com^$third-party
+||ijmzezsaxxomr.com^$third-party
+||ijnghdmfrb.com^$third-party
+||ijowsfraldsnb.com^$third-party
+||ijriehir.com^$third-party
+||ijterttmus.com^$third-party
 ||ijuawecwqhwyou.bid^$third-party
 ||ijvolcqtnxohl.com^$third-party
 ||ijyzkjjabc.bid^$third-party
@@ -41973,70 +40502,111 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||ikealcmavhpk.com^$third-party
 ||ikfmafgtgnylts.com^$third-party
 ||ikgxfzfjxmp.bid^$third-party
+||ikhdsnufzzj.com^$third-party
 ||ikmmsoihdmfkbh.bid^$third-party
 ||ikmymeivze.com^$third-party
 ||iknctklddhoh.com^$third-party
 ||ikobsqwcutnss.com^$third-party
 ||ikpzwbrzzfg.bid^$third-party
 ||ikrvzjdds.bid^$third-party
+||ikupicwg.com^$third-party
 ||ikuzqysewaw.bid^$third-party
+||ikvagxovc.com^$third-party
 ||ikvfgsftmyhn.com^$third-party
 ||ikvltjooosqh.com^$third-party
 ||ikvuvztmvvro.bid^$third-party
 ||ikxdpmnznk.bid^$third-party
 ||ikxhjlsynfeo.com^$third-party
+||ilaantxayy.com^$third-party
 ||ilakffljjdpwb.com^$third-party
+||ilclngnarpy.com^$third-party
 ||ilfsrsgmgbex.com^$third-party
+||ilkphyyzg.com^$third-party
+||illazkka.com^$third-party
 ||illizuqkdqjobt.com^$third-party
 ||illqbirymsr.com^$third-party
+||ilqufadqxd.com^$third-party
 ||ilrxikdjozlk.com^$third-party
 ||ilsivrexvpyv.com^$third-party
+||ilugfyhlfv.com^$third-party
 ||ilupcgzhagwb.com^$third-party
+||iluwjbuwm.com^$third-party
 ||ilvibsabwuza.com^$third-party
+||ilxwlsnzhzukj.com^$third-party
+||ilzwenpgf.com^$third-party
+||imayjubge.com^$third-party
 ||imbbjywwahev.com^$third-party
+||imbpmlyhkk.com^$third-party
+||imeljiehhwy.com^$third-party
+||imevdywafhro.com^$third-party
 ||imgoatxhxior.com^$third-party
+||imidshmpzr.com^$third-party
 ||imisagsrbci.com^$third-party
 ||immgnzenbixuzd.bid^$third-party
+||immscjnenl.com^$third-party
+||imnsmvmjrdiwwr.com^$third-party
 ||imqkdsdgfygm.com^$third-party
 ||imrwxmau.com^$third-party
 ||imtdtaloqwcz.com^$third-party
 ||imyqdbxq.com^$third-party
 ||imzngbreiiiv.com^$third-party
+||imzuoqkrzrjw.com^$third-party
 ||incdjkjbyhlttx.com^$third-party
 ||inewoioxxdbm.com^$third-party
+||inhcrirmboz.com^$third-party
 ||inhtwazkrebui.bid^$third-party
 ||inisvnawtzevnx.com^$third-party
+||injjmtlzq.com^$third-party
 ||inmrjokdxmkh.com^$third-party
 ||insbrvwfrcgb.com^$third-party
 ||invgsoqwtkvxs.bid^$third-party
 ||inxhtjrwictg.com^$third-party
 ||ioatyggwaypq.com^$third-party
+||iogutpkrkkycq.com^$third-party
 ||iohaqrkjddeq.com^$third-party
 ||iohyjoomzoufn.bid^$third-party
 ||ioighavxylne.com^$third-party
 ||ioitfufxdsxtq.bid^$third-party
+||ioiylgyf.com^$third-party
 ||iokggekuz.bid^$third-party
 ||iolzwhbf.bid^$third-party
 ||iomixrscvtw.bid^$third-party
 ||ionbpysfukdh.com^$third-party
 ||iooxsrjgkb.bid^$third-party
+||ioppxhhtgbydsj.com^$third-party
 ||ioryejnzvbbluh.bid^$third-party
+||ioujbpldicfgm.com^$third-party
 ||ioupfmge.com^$third-party
 ||ioyixcprbghm.com^$third-party
+||iozpujvmlojzhp.com^$third-party
+||ipacpdxmvwyi.com^$third-party
 ||ipadxqhm.bid^$third-party
 ||ipcouosurtdqc.bid^$third-party
 ||ipdcgsdjkz.bid^$third-party
 ||ipdlsrwctdjb.com^$third-party
+||ipehunxxyir.com^$third-party
+||ipesdpqmq.com^$third-party
+||ipesuojab.com^$third-party
+||ipfcvsxisyz.com^$third-party
+||iphliojn.com^$third-party
 ||iphwttyqzuhucw.bid^$third-party
 ||ipllxfcftp.com^$third-party
+||ipluhckk.com^$third-party
+||ipncblpgxlhjpc.com^$third-party
 ||ipndulsempjgb.bid^$third-party
 ||ipntpfokhkrh.com^$third-party
 ||ippninrrcl.com^$third-party
+||ippwkczttno.com^$third-party
 ||iptrkboffhf.com^$third-party
 ||ipvvitntvja.com^$third-party
+||ipwwqitqsh.com^$third-party
+||ipxdoldjsvnjvw.com^$third-party
 ||ipytvgqfh.bid^$third-party
 ||ipzjwnbhgymuw.com^$third-party
+||iqagrsach.com^$third-party
+||iqbfctebbzh.com^$third-party
 ||iqmjedevvojm.com^$third-party
+||iqopeoufjul.com^$third-party
 ||iqpfextjfphjnn.com^$third-party
 ||iqqbwhrf.com^$third-party
 ||iqrqmhrfkyuu.com^$third-party
@@ -42044,58 +40614,89 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||iqwbqjnst.bid^$third-party
 ||iqwczlbxvtcnh.com^$third-party
 ||iqwhwomdmjg.bid^$third-party
+||iqyirwfzlx.com^$third-party
 ||irbipwnr.bid^$third-party
 ||irbkobqlrbtt.com^$third-party
 ||iretlniy.bid^$third-party
+||irfiysdcrnleu.com^$third-party
 ||irjaeupzarkvwmxonaeslgicvjvgdruvdywmdvuaoyfsjgdzhk.com^$third-party
 ||irlklysyeqek.bid^$third-party
 ||irmfncjihlb.com^$third-party
 ||iroktywi.bid^$third-party
+||irpaknbwgif.com^$third-party
 ||irrhjkuantnaa.bid^$third-party
 ||irrttzthsxot.com^$third-party
 ||irtxsagfqrg.com^$third-party
+||irvelcchuvsis.com^$third-party
 ||irxpndjg.com^$third-party
 ||irxtcbkoql.bid^$third-party
 ||irzdishtggyo.com^$third-party
 ||isbzjaedbdjr.com^$third-party
 ||iscaebizkzyd.com^$third-party
 ||isdlyvhegxxz.com^$third-party
+||isfmvohloskgw.com^$third-party
 ||isfouztifttwha.bid^$third-party
+||isfxsiooyjad.com^$third-party
 ||isggimkjabpa.com^$third-party
 ||ishdyglxfckw.com^$third-party
 ||ishwuhvow.bid^$third-party
+||isnsgjhthhaqtu.com^$third-party
+||ispaagigjygd.com^$third-party
 ||ispyveemlvygba.com^$third-party
+||isqbthtlvazequ.com^$third-party
 ||isqgobsgtqsh.com^$third-party
+||isrecblqmlzi.com^$third-party
 ||isvwylcazk.com^$third-party
+||isxwajatbig.com^$third-party
 ||itbiwlsxtigx.com^$third-party
 ||itdfougdewupfd.bid^$third-party
 ||itevcsjvtcmb.com^$third-party
 ||itgfqliqge.com^$third-party
+||itlmnxlauah.com^$third-party
 ||itsskxyyi.bid^$third-party
+||itsyuvrlesq.com^$third-party
+||itxljhric.com^$third-party
+||itzgybxfrbodq.com^$third-party
 ||iuabiwhclldt.com^$third-party
+||iuawzhuqjl.com^$third-party
+||iucpxetj.com^$third-party
 ||iuewancpgd.bid^$third-party
+||iuhojiqev.com^$third-party
+||iuhpbpzwpldqbj.com^$third-party
 ||iuhzosuy.club^$third-party
 ||iukvnikhn.bid^$third-party
+||iuncajvw.com^$third-party
+||iuooczzbi.com^$third-party
+||iuowwbrqblweoa.com^$third-party
 ||iupqelechcmj.com^$third-party
 ||iuumkigdfcz.com^$third-party
 ||iuymaolvzery.com^$third-party
 ||ivebuyrkn.com^$third-party
+||ivfwajwbhiwzw.com^$third-party
 ||ivildmcafzped.bid^$third-party
 ||ivkasohqerzl.com^$third-party
 ||ivktdwmjhkqy.com^$third-party
 ||ivldzqidbv.com^$third-party
 ||ivnpbikks.com^$third-party
+||ivowhzku.com^$third-party
 ||ivqoqtozlmjp.com^$third-party
 ||ivqvzkwedcjo.com^$third-party
 ||ivsqnmridfxn.com^$third-party
 ||ivuhwsqnbjjx.bid^$third-party
 ||ivuqekelizp.bid^$third-party
+||ivvoooxuyjfuo.com^$third-party
 ||ivyfsbbwsf.com^$third-party
+||iwapwcqg.com^$third-party
 ||iwbwvowdidkuo.com^$third-party
 ||iweacndqhiht.com^$third-party
+||iwfzluau.com^$third-party
+||iwgdguuz.com^$third-party
 ||iwmonrwpeeku.com^$third-party
 ||iwnvbdosun.bid^$third-party
 ||iwptktyoq.bid^$third-party
+||iwpxkwojbw.com^$third-party
+||iwqownwjbk.com^$third-party
+||iwqsvntvdry.com^$third-party
 ||iwquafxm.com^$third-party
 ||iwqugvxozbkd.com^$third-party
 ||iwrjczthkkla.com^$third-party
@@ -42103,30 +40704,54 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||iwztirze.com^$third-party
 ||ixbccovgriz.bid^$third-party
 ||ixbuuqymufxas.com^$third-party
+||ixdqmmovnvbkl.com^$third-party
+||ixhcokzelvvxs.com^$third-party
+||ixkbavqbpsm.com^$third-party
 ||ixlsylapsdtr.com^$third-party
 ||ixnsmcpdauof.com^$third-party
 ||ixqpfqtwi.bid^$third-party
 ||ixrtmzmk.bid^$third-party
 ||ixsgoqeklwsjw.com^$third-party
+||ixskusmnsb.com^$third-party
+||ixsogpaexhgzn.com^$third-party
 ||ixsxgaegvplo.com^$third-party
 ||ixtkiofaoudis.com^$third-party
+||ixtmbdajhvimtv.com^$third-party
+||ixuytaxnu.com^$third-party
 ||ixvsxjiw.com^$third-party
+||ixvzraajuiniwg.com^$third-party
+||ixwbgjnjf.com^$third-party
+||ixxstrxhxvxbwl.com^$third-party
 ||ixzhwyuxxvxb.com^$third-party
 ||ixznwuxokydz.com^$third-party
+||iybkbyciv.com^$third-party
 ||iydghotpzofn.com^$third-party
+||iydppfwjgcjs.com^$third-party
+||iyfrmewyned.com^$third-party
 ||iygdvith.com^$third-party
 ||iyivpsxzgjcarv.bid^$third-party
 ||iyjukpbyzsxc.bid^$third-party
+||iykehvusfrt.com^$third-party
+||iykrtmswkibdp.com^$third-party
+||iylndfmf.com^$third-party
 ||iylssoobxtvm.com^$third-party
 ||iynfhmgte.bid^$third-party
+||iyqchvtlklbxm.com^$third-party
 ||iyqnxpkzfq.com^$third-party
 ||iytfczscguf.bid^$third-party
+||izavihllfvej.com^$third-party
+||izedcwsouaszk.com^$third-party
 ||izelshnkrh.com^$third-party
+||izfaiqnxxts.com^$third-party
 ||izgnfkvpiawwn.bid^$third-party
+||izgxbakxatp.com^$third-party
 ||izhmxwivr.com^$third-party
 ||izhvnderudte.com^$third-party
 ||iziwhlafxitn.com^$third-party
 ||izixtxrvogaq.com^$third-party
+||izjguvanm.com^$third-party
+||izkcesinsyz.com^$third-party
+||izlrmsjdntfhpr.com^$third-party
 ||izlzayrcegfvke.bid^$third-party
 ||izmciznsszatv.com^$third-party
 ||izmwtewwobxy.com^$third-party
@@ -42134,11 +40759,17 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||iztsbnkxphnj.com^$third-party
 ||iztxikfgw.com^$third-party
 ||izwsvyqv.com^$third-party
+||izwzyhlm.com^$third-party
 ||izxdpodiowdgp.bid^$third-party
+||jaaqcdrpmyju.com^$third-party
 ||jabcdkwmwnek.com^$third-party
+||jacmnkcusf.com^$third-party
 ||jacroxrssmme.bid^$third-party
 ||jahsrhlp.com^$third-party
+||jaihowgr.com^$third-party
 ||jairtejvkqiux.com^$third-party
+||jajkgegza.com^$third-party
+||jakzpcgrxgda.com^$third-party
 ||jakzxxzrymhz.com^$third-party
 ||jamkkydyiyhx.com^$third-party
 ||jamvgopociy.bid^$third-party
@@ -42150,28 +40781,43 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||jaxmbkhyr.com^$third-party
 ||jbarrxmpmmekwh.bid^$third-party
 ||jbbgczjipjvb.com^$third-party
+||jbcadlpdfsxsfe.com^$third-party
+||jbdddxgjn.com^$third-party
 ||jbgehhqvfppf.com^$third-party
 ||jbgzahhyhen.com^$third-party
 ||jbhrcrhbiyshoz.bid^$third-party
+||jbiqepilzn.com^$third-party
+||jbkxmktmatzk.com^$third-party
 ||jboovenoenkh.com^$third-party
 ||jbpyqajzwbh.bid^$third-party
 ||jbqolazohwqesu.com^$third-party
 ||jbvisobwrlcv.com^$third-party
 ||jbvyjtyhatpam.com^$third-party
 ||jbwlscjgbznhu.bid^$third-party
+||jbwunmehf.com^$third-party
+||jbxggecaj.com^$third-party
 ||jbyksmjmbmku.com^$third-party
 ||jcblfhpmxqflm.bid^$third-party
 ||jccdpudtb.bid^$third-party
+||jccszmkabdean.com^$third-party
 ||jcctggmdccmt.com^$third-party
 ||jcgvmfaby.bid^$third-party
 ||jciieszytnk.bid^$third-party
+||jcjrcmaunbqxg.com^$third-party
+||jcllysqtvlro.com^$third-party
+||jcmdvfrn.com^$third-party
 ||jcnoeyqsdfrc.com^$third-party
+||jcrqhscfqqbgby.com^$third-party
+||jcsisvtb.com^$third-party
 ||jctszdppy.bid^$third-party
 ||jcwejhrrch.bid^$third-party
+||jcxghdlrrmyy.com^$third-party
 ||jcytzfvrm.bid^$third-party
 ||jczpcviiurut.bid^$third-party
+||jdbovkzjtuup.com^$third-party
 ||jdbzloynedpylr.bid^$third-party
 ||jdcwnccdx.com^$third-party
+||jddghmkf.com^$third-party
 ||jdgilrlyqtrly.com^$third-party
 ||jdhhehwkvl.com^$third-party
 ||jdhnfbmrhwkn.com^$third-party
@@ -42180,67 +40826,110 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||jdmconkw.com^$third-party
 ||jdnbrccndsxly.bid^$third-party
 ||jdniyyricenx.com^$third-party
+||jdolsuyshcz.com^$third-party
+||jdrckkbpb.com^$third-party
 ||jdrlnicvn.com^$third-party
+||jdskyjntuhea.com^$third-party
 ||jdtufqcyumvb.com^$third-party
+||jducqfnxeypyw.com^$third-party
 ||jdzmcidlajwwzi.bid^$third-party
 ||jeakofzseo.com^$third-party
 ||jebfktzfjqghv.bid^$third-party
 ||jebuorwrqfflzl.com^$third-party
+||jecbbkrnfn.com^$third-party
 ||jednyqbb.com^$third-party
+||jeeumttalzwt.com^$third-party
+||jegugqcvo.com^$third-party
 ||jeksffryglas.com^$third-party
 ||jemopaqkst.com^$third-party
 ||jemyvtomzyha.com^$third-party
+||jenaowzhtbi.com^$third-party
 ||jeqixokniyny.com^$third-party
 ||jertwakjcaym.com^$third-party
 ||jeuqrslzoxdcz.com^$third-party
 ||jevijshpvnwm.com^$third-party
+||jevxjcdnrd.com^$third-party
 ||jeyoxmhhnofdhaalzlfbrsfmezfxqxgwqjkxthzptjdizuyojh.com^$third-party
 ||jeyuhcbagxbp.com^$third-party
 ||jezqighae.bid^$third-party
 ||jfaqiomgvajb.com^$third-party
 ||jfcofvhuqzdg.bid^$third-party
+||jffdktcyr.com^$third-party
 ||jffhbunkrxmyhf.bid^$third-party
 ||jffwwuyychxw.com^$third-party
 ||jfhupoqrydm.com^$third-party
+||jfjuhxfllw.com^$third-party
 ||jfkfojgkrk.com^$third-party
+||jfnafbcysy.com^$third-party
 ||jfribvstvcqy.com^$third-party
+||jfvadxjr.com^$third-party
+||jfvjtudp.com^$third-party
 ||jfvoyuxmp.bid^$third-party
 ||jfwfnxsdzhvxax.bid^$third-party
 ||jfxiirxbl.bid^$third-party
 ||jfxjpswhcwwq.com^$third-party
+||jgedbspzlrjhp.com^$third-party
+||jgerrmaktdzyh.com^$third-party
+||jgjpicgy.com^$third-party
 ||jgophcykrckik.com^$third-party
 ||jgqcraids.com^$third-party
 ||jgqkrvjtuapt.com^$third-party
 ||jgrcggutsilp.com^$third-party
+||jgrsqcqdfwzu.com^$third-party
 ||jgsoloqaqp.com^$third-party
 ||jgtnayftk.bid^$third-party
+||jguczdjzvfp.com^$third-party
 ||jguhktakkykrsb.com^$third-party
 ||jgvjzbrnjmxoq.com^$third-party
 ||jgxlxsnqz.bid^$third-party
+||jhceybuguvureg.com^$third-party
+||jhcnnizbua.com^$third-party
+||jheduynirrxkro.com^$third-party
 ||jheplryxvzvx.com^$third-party
 ||jhewbownkjobl.bid^$third-party
+||jhijojlatyvri.com^$third-party
+||jhmmbrfsqm.com^$third-party
 ||jhnteodwqtk.com^$third-party
+||jhpceldehkofgj.com^$third-party
 ||jhrmgusalkdu.com^$third-party
 ||jhupypvmcsqfqpbxbvumiaatlilzjrzbembarnhyoochsedzvi.com^$third-party
+||jhutqqddwi.com^$third-party
+||jhwkypuhrw.com^$third-party
 ||jhwqdpyo.bid^$third-party
+||jhxpbihkucrq.com^$third-party
+||jhybwydghelnd.com^$third-party
 ||jhylgkwsz.bid^$third-party
 ||jiifnvkesug.com^$third-party
+||jiiyddosyv.com^$third-party
 ||jijcetagjfzo.com^$third-party
+||jikottnbg.com^$third-party
+||jimqcqsyhser.com^$third-party
+||jimxaqrpqbxldt.com^$third-party
+||jioivnytpmam.com^$third-party
+||jipzvmzzycg.com^$third-party
+||jirmbsgr.com^$third-party
 ||jiruygrsl.com^$third-party
+||jitvspfwwmzcu.com^$third-party
+||jivnpidyteh.com^$third-party
 ||jixvywxefnwm.com^$third-party
 ||jiyairvjgfqk.com^$third-party
 ||jiycfyytg.com^$third-party
+||jiyvkdfab.com^$third-party
 ||jjbnkgdpsm.com^$third-party
 ||jjdrwkistgfh.com^$third-party
 ||jjeevbcllev.bid^$third-party
 ||jjekiezbshyo.com^$third-party
+||jjhnnzef.com^$third-party
 ||jjipgxjf.com^$third-party
 ||jjmuyvpery.bid^$third-party
 ||jjokekbfoxwip.com^$third-party
+||jjokvprdxwf.com^$third-party
 ||jjpnveujkk.com^$third-party
 ||jjpoxurorlsb.com^$third-party
+||jjptjphnkrqnc.com^$third-party
 ||jjqoosuum.com^$third-party
 ||jjrzlqho.com^$third-party
+||jjvdpetfxbjdbq.com^$third-party
 ||jjwitnosyew.bid^$third-party
 ||jjxaibzdypcb.com^$third-party
 ||jjxsdkphpcwu.com^$third-party
@@ -42248,33 +40937,50 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||jjyovwimoydq.com^$third-party
 ||jjyysfxhn.com^$third-party
 ||jjzqygrh.com^$third-party
+||jkamuwyswgk.com^$third-party
+||jkawfxvh.com^$third-party
+||jkciacmcnya.com^$third-party
+||jkcvevwvgfopog.com^$third-party
+||jkcyrdigvx.com^$third-party
 ||jkfgdkesrpx.bid^$third-party
 ||jkiicqewzn.com^$third-party
 ||jkiwvfgrsythrw.com^$third-party
+||jkjcoyeeglunz.com^$third-party
 ||jkjoxlhkwnxd.com^$third-party
 ||jkjwifmep.com^$third-party
 ||jkkernvkrwdr.com^$third-party
 ||jkoiwpjk.bid^$third-party
 ||jkpdxsqpyl.bid^$third-party
+||jkpsxhvjduxexm.com^$third-party
 ||jkuuoecpgecwla.com^$third-party
+||jkvkhgztow.com^$third-party
 ||jkxzawjvp.bid^$third-party
+||jkywbooyc.com^$third-party
 ||jlarmqbypyku.com^$third-party
 ||jldnphwwu.bid^$third-party
 ||jldstutlnz.com^$third-party
 ||jlflzjdt.com^$third-party
+||jlgtjteei.com^$third-party
 ||jlhkteiqgvafic.com^$third-party
+||jlkadizug.com^$third-party
+||jlkqurysdsw.com^$third-party
 ||jllveksikabohj.bid^$third-party
 ||jllzvqolrdu.bid^$third-party
 ||jlmirsfthnmh.com^$third-party
+||jlmnnrwuqz.com^$third-party
 ||jlppkzffsksna.com^$third-party
 ||jlqmdejwvezpt.com^$third-party
 ||jlqpkoppbxa.com^$third-party
 ||jlslujfguojw.com^$third-party
+||jlsydeysmgghdy.com^$third-party
+||jlvqbfknjajot.com^$third-party
+||jlwejibe.com^$third-party
 ||jlwlfcbfifsvfw.com^$third-party
 ||jlymmwnkxhph.com^$third-party
 ||jmbhyqijqhxk.com^$third-party
 ||jmbyjmeleib.bid^$third-party
 ||jmemwbkpj.bid^$third-party
+||jmewxbvmcjmur.com^$third-party
 ||jmextrjbse.com^$third-party
 ||jmghohdn.bid^$third-party
 ||jmimktvupp.com^$third-party
@@ -42283,16 +40989,25 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||jmqxufpbikzk.bid^$third-party
 ||jmvjmgofvxnu.com^$third-party
 ||jmxjwyqnelvzwu.com^$third-party
+||jmxphjxsxd.com^$third-party
 ||jmzaqwcmcbui.com^$third-party
 ||jnchbwtzbrrf.com^$third-party
 ||jncjzdohkgic.com^$third-party
 ||jndclagxkvpn.com^$third-party
+||jndnkgjqlxr.com^$third-party
 ||jnercechoqjb.com^$third-party
 ||jngnaymz.com^$third-party
+||jngxxwythaf.com^$third-party
+||jnhjvkapqf.com^$third-party
+||jnhmeywrl.com^$third-party
+||jnjbdvchvk.com^$third-party
 ||jnlcnmin.bid^$third-party
+||jnljkbkiaqcmb.com^$third-party
 ||jnnjnuyiic.com^$third-party
 ||jnnmisngfscreq.bid^$third-party
+||jnnswtdifjgx.com^$third-party
 ||jnoaexgpdlnu.com^$third-party
+||jnqbgmlapkkrsj.com^$third-party
 ||jnwsojzuahwbeq.com^$third-party
 ||jnxqlltlnezn.com^$third-party
 ||jnylpjlnjfsp.com^$third-party
@@ -42303,59 +41018,90 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||jogccrwnpsmliq.bid^$third-party
 ||jogpsoiyngua.com^$third-party
 ||jogrgddvb.com^$third-party
+||johonmtpyv.com^$third-party
 ||jollqxplkz.bid^$third-party
 ||jomznuefrw.com^$third-party
 ||joqnoyniblzm.com^$third-party
 ||joqpatxugyug.com^$third-party
 ||jorndvyzchaq.com^$third-party
+||josxzdszqaivb.com^$third-party
+||jotpybmcjvg.com^$third-party
 ||jovepjufhmmw.com^$third-party
 ||jovzikimk.com^$third-party
 ||joxocqrbxe.bid^$third-party
+||joynxonnxfnvqr.com^$third-party
+||jozfwcmrxkwva.com^$third-party
+||jpabviwck.com^$third-party
 ||jpcfosuswcqy.com^$third-party
+||jpdauipgz.com^$third-party
 ||jpflmmxdflmm.com^$third-party
 ||jpgjjzvcfrwlzh.bid^$third-party
 ||jphwssfvoddoi.com^$third-party
 ||jpjgbiuoziih.com^$third-party
 ||jpmcviivqg.bid^$third-party
+||jpmpvhelfeg.com^$third-party
+||jpmyudcnpgl.com^$third-party
 ||jpncpftyxliq.com^$third-party
 ||jpnudjqejbpx.bid^$third-party
+||jpogcxdaxco.com^$third-party
+||jpqmviofsf.com^$third-party
 ||jprtqxwhtrjejx.com^$third-party
 ||jpuiucicqwan.com^$third-party
+||jpvmwnnwuzo.com^$third-party
 ||jpwvdpvsmhow.com^$third-party
+||jpxevzab.com^$third-party
 ||jpybcyxyepsc.bid^$third-party
+||jqanygfhqne.com^$third-party
 ||jqdfakgwsxvccl.bid^$third-party
 ||jqdwgguusof.bid^$third-party
 ||jqfkitrkhpxl.com^$third-party
+||jqgblwjfvox.com^$third-party
 ||jqibqqxghcfk.com^$third-party
 ||jqinqsrmygeu.com^$third-party
 ||jqkxaejcijfz.com^$third-party
 ||jqleeknw.com^$third-party
 ||jqmcbepfjgks.com^$third-party
 ||jqojocdbjpdyk.bid^$third-party
+||jqpccewciuzj.com^$third-party
+||jqpuxvgnxkf.com^$third-party
+||jqqlucchmbxnn.com^$third-party
 ||jqqrcwwd.com^$third-party
+||jqrnfkttwfxbcu.com^$third-party
+||jqsrfzjgn.com^$third-party
 ||jqtftqnkhsw.bid^$third-party
 ||jqtsknmobyw.com^$third-party
 ||jqtwygdajic.com^$third-party
 ||jqusvvfzw.bid^$third-party
 ||jqvlsavxawfr.com^$third-party
+||jractwjn.com^$third-party
+||jrarnqfvjijaa.com^$third-party
 ||jrauyqdbit.bid^$third-party
 ||jrcpoxuskv.com^$third-party
 ||jrdxlxdnohjzs.bid^$third-party
+||jrecvuklrjpli.com^$third-party
+||jrikmexrknmxy.com^$third-party
 ||jrlnmyorquny.bid^$third-party
 ||jrlsithadutpm.com^$third-party
 ||jrmyhchnfawh.com^$third-party
+||jrrekpskc.com^$third-party
 ||jrrmwjybfaztct.com^$third-party
 ||jrtawlpbusyg.com^$third-party
 ||jrtzehrbg.com^$third-party
+||jrunvrfma.com^$third-party
+||jruovuiejirpev.com^$third-party
 ||jryyekccnw.com^$third-party
 ||jryywrczwcfmw.com^$third-party
 ||jseewggtkfrs.com^$third-party
 ||jshjrozmwmyj.com^$third-party
 ||jtacrwtaf.com^$third-party
 ||jtbmxdoadktnm.com^$third-party
+||jtgckwsacymph.com^$third-party
 ||jtmfmeexjet.bid^$third-party
+||jtmwjkkoes.com^$third-party
 ||jtqfggxxk.bid^$third-party
+||jttoioquq.com^$third-party
 ||jtumenosmrte.com^$third-party
+||jtveisrh.com^$third-party
 ||jtypnunbjzma.com^$third-party
 ||jtzlsdmbmfms.com^$third-party
 ||jugehjohbc.com^$third-party
@@ -42366,104 +41112,165 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||jumhqsxgnkuvfn.bid^$third-party
 ||junwkfyb.bid^$third-party
 ||juoyynafgp.bid^$third-party
+||juqakqgv.com^$third-party
 ||juqmlmoclnhe.com^$third-party
 ||jusrlkubhjnr.com^$third-party
 ||jutbdkjc.bid^$third-party
+||juuwyyvjecnvps.com^$third-party
+||juvqtttkhz.com^$third-party
 ||juvyntuqtku.bid^$third-party
 ||juyfhwxcvzft.com^$third-party
 ||jvdrscohwxopj.bid^$third-party
 ||jvepcgbq.bid^$third-party
 ||jvffngzl.com^$third-party
 ||jvhdxosisifv.com^$third-party
+||jvinenwuarwn.com^$third-party
+||jvjwaxjixypm.com^$third-party
+||jvkhhxwcnijvmf.com^$third-party
 ||jvmuayuilxn.com^$third-party
 ||jvnubhidaev.bid^$third-party
 ||jvnvvuveozfi.com^$third-party
 ||jvodizomnxtg.com^$third-party
+||jvqbbfrg.com^$third-party
 ||jvrbjipsyyc.bid^$third-party
 ||jvriybgxne.com^$third-party
+||jvykohlq.com^$third-party
+||jvzwcgobd.com^$third-party
 ||jwbdezxfl.bid^$third-party
+||jwbroglwc.com^$third-party
 ||jwbuxywauut.com^$third-party
 ||jwcpqgfhlrt.com^$third-party
 ||jwfdyujffrzt.com^$third-party
+||jwgsepzz.com^$third-party
 ||jwjztdbakqqk.com^$third-party
+||jwmnryeoc.com^$third-party
 ||jwnlqtdvnm.bid^$third-party
+||jwuvfovjzwe.com^$third-party
 ||jwwlyiicjkuh.com^$third-party
 ||jwwotfckxcyv.bid^$third-party
+||jwwyuxjv.com^$third-party
 ||jwzegfmsgyba.com^$third-party
 ||jwzuohydf.com^$third-party
 ||jxanmrdurjhw.com^$third-party
+||jxexqemgbxvv.com^$third-party
 ||jxfhshgavg.bid^$third-party
 ||jxfplvnrg.com^$third-party
 ||jxgbdhbilbsgf.bid^$third-party
 ||jxhmvjrpkdyn.com^$third-party
+||jxkelzfrk.com^$third-party
+||jxmhgmkuw.com^$third-party
 ||jxnbwgea.bid^$third-party
+||jxnwpeqkhtkrw.com^$third-party
+||jxseoruuv.com^$third-party
 ||jxsixnzrm.bid^$third-party
 ||jxuezvyaakks.com^$third-party
+||jxusrymeeqyi.com^$third-party
 ||jxvhdyguseaf.com^$third-party
 ||jxxjndvcf.bid^$third-party
 ||jyaaeiqm.com^$third-party
+||jyahmckzsbh.com^$third-party
 ||jyauuwrrigim.com^$third-party
+||jyccdcavzpqt.com^$third-party
 ||jydbctzvbqrh.com^$third-party
 ||jyezgitcx.com^$third-party
 ||jynbcpfwvazazd.com^$third-party
+||jynhztwrsl.com^$third-party
 ||jypmcknqvnfd.com^$third-party
 ||jyrjjhdas.bid^$third-party
 ||jyryxwvdjqobg.bid^$third-party
 ||jyttehhwlm.com^$third-party
+||jyujouii.com^$third-party
 ||jyxckvhds.bid^$third-party
+||jyymhnyr.com^$third-party
 ||jyzhiusk.bid^$third-party
 ||jzbarlrhbicg.com^$third-party
 ||jzbskhgpivyl.com^$third-party
+||jzbutifk.com^$third-party
 ||jzckyzvlxetror.com^$third-party
 ||jzekquhmaxrk.com^$third-party
+||jzfzgkepkjcf.com^$third-party
+||jzgtnetghdc.com^$third-party
 ||jzigsobgsmxdmr.bid^$third-party
+||jzjhcpdf.com^$third-party
+||jzkznpleaqshdj.com^$third-party
+||jzllgntkazui.com^$third-party
 ||jzlzdnvvktcf.com^$third-party
+||jzqemifphogo.com^$third-party
 ||jzqharwtwqei.com^$third-party
+||jzqoddurnu.com^$third-party
+||jzqvmpkppjlgc.com^$third-party
+||jzsafhhk.com^$third-party
 ||jzthapvjlq.bid^$third-party
+||jzudyqjkmbwbsf.com^$third-party
 ||jzurzhjqrp.com^$third-party
 ||jzvuglclkdnb.bid^$third-party
 ||jzxlkhaugzuaqm.bid^$third-party
+||kacfofrcndc.com^$third-party
 ||kadjwdpzxdxd.com^$third-party
 ||kahbkhlb.bid^$third-party
+||kajnvrmlftojxu.com^$third-party
+||kaktokualscgea.com^$third-party
+||kakywxgevuv.com^$third-party
+||kalfiydydtnhxk.com^$third-party
 ||kallwqgnec.com^$third-party
+||kaojrivmhys.com^$third-party
 ||kaqtvgcy.bid^$third-party
 ||karcvrpwayal.com^$third-party
 ||karownxatpbd.com^$third-party
+||katxkxcncwool.com^$third-party
 ||kayfdraimewk.com^$third-party
 ||kayophjgzqdq.com^$third-party
+||kbdstwnruc.com^$third-party
 ||kbgphmpg.bid^$third-party
 ||kbguruenim.bid^$third-party
+||kbgyxsoskilli.com^$third-party
 ||kbipxydhakpdwj.bid^$third-party
 ||kbjddmnkallz.com^$third-party
+||kbkvptlxijafb.com^$third-party
 ||kbluliqpjq.bid^$third-party
 ||kbnhoiax.com^$third-party
+||kbpijqva.com^$third-party
 ||kbprllyfvqns.bid^$third-party
+||kbqebfcubeiaa.com^$third-party
 ||kbrnfzgglehh.com^$third-party
+||kbrpiuql.com^$third-party
 ||kbrwlgzazfnv.com^$third-party
 ||kbsceyleonkq.com^$third-party
+||kbtoiwayyezse.com^$third-party
+||kbwortdqjbns.com^$third-party
 ||kbxkcmpd.bid^$third-party
 ||kbzmhlsg.com^$third-party
 ||kbzrszspknla.com^$third-party
 ||kbzvtvgwkut.bid^$third-party
+||kcarnzeaipjssg.com^$third-party
 ||kcchjeoufbqu.com^$third-party
 ||kcctsiusemgdl.com^$third-party
 ||kceikbfhsnet.com^$third-party
 ||kceptbgdczkd.bid^$third-party
+||kcetcukaolxc.com^$third-party
 ||kcgmgnejfp.bid^$third-party
+||kcitwbcc.com^$third-party
+||kcnyhfmowc.com^$third-party
+||kcodndvh.com^$third-party
+||kcpntbycuswz.com^$third-party
 ||kcqdidtq.bid^$third-party
+||kcugdqmmfcqrb.com^$third-party
 ||kcwvkoxn.com^$third-party
 ||kdaskxrcgxhp.com^$third-party
 ||kdekyymbn.bid^$third-party
+||kdfjjvidllnbaa.com^$third-party
 ||kdhkjeklzihiwh.com^$third-party
 ||kdhndryipp.com^$third-party
 ||kdiunbsaw.com^$third-party
 ||kdkzvfzmgvm.com^$third-party
 ||kdmilqoiaucqto.com^$third-party
+||kdpqydaxbxztnh.com^$third-party
 ||kdtictjmofbl.com^$third-party
 ||kdtrdexby.com^$third-party
 ||kdtstmiptmvk.com^$third-party
 ||kdvcvkwwtbwn.com^$third-party
 ||kdwygzatplqrao.bid^$third-party
+||kdyfsgpa.com^$third-party
 ||kecldktirqzk.com^$third-party
 ||keeedoleeroe.com^$third-party
 ||keellcvwpzgj.com^$third-party
@@ -42478,18 +41285,33 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||kflimllvanjv.com^$third-party
 ||kfpkzbgwuxm.bid^$third-party
 ||kfpwayrztgjj.com^$third-party
+||kfqronzxcrdt.com^$third-party
+||kfritiigmqk.com^$third-party
 ||kftbvzlrqkakfo.com^$third-party
 ||kftmmtuxdtmsv.bid^$third-party
 ||kfuwxxspanifp.bid^$third-party
 ||kfwhcwoc.com^$third-party
 ||kfwpyyctzmpk.com^$third-party
+||kfxrukfzqazrs.com^$third-party
+||kfyhxmycgjaqkn.com^$third-party
+||kfyksytsx.com^$third-party
+||kfypsloqkccvpl.com^$third-party
 ||kfzimhbhjdqa.com^$third-party
+||kgdglkxy.com^$third-party
 ||kgdmlsbtd.com^$third-party
 ||kgkjlivo.com^$third-party
+||kgkkfrvujnqf.com^$third-party
 ||kgnxtdcf.bid^$third-party
+||kgobpqziy.com^$third-party
+||kgqlrcjlrx.com^$third-party
 ||kgvgtudoridc.com^$third-party
+||kgxemdznctlmya.com^$third-party
+||kgzcentyfo.com^$third-party
 ||kgzuerzjysxw.com^$third-party
+||khaicoojypokng.com^$third-party
 ||khaklikrt.com^$third-party
+||khdmabhykmj.com^$third-party
+||khefhmgfwnnqgv.com^$third-party
 ||khexythfkw.com^$third-party
 ||khgsbhdw.bid^$third-party
 ||khgwakmfavzch.bid^$third-party
@@ -42499,21 +41321,30 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||khpgychzfdmpm.bid^$third-party
 ||khwfemkr.bid^$third-party
 ||khzbeucrltin.com^$third-party
+||kieecarfftwf.com^$third-party
+||kiejztfpkfayak.com^$third-party
+||kifxgosycvxplk.com^$third-party
 ||kihhgldtpuho.com^$third-party
 ||kihmdiimzzab.bid^$third-party
 ||kihxncfpkimfx.bid^$third-party
 ||kiinvgntnnw.com^$third-party
 ||kiixmhyrlawz.com^$third-party
+||kimqbvkaidbwst.com^$third-party
+||kiobmbncsrwc.com^$third-party
 ||kiochlocj.bid^$third-party
 ||kiodudldzmzwr.com^$third-party
 ||kiohmgklwi.com^$third-party
 ||kioxprngouirqu.com^$third-party
+||kioxqnfhyh.com^$third-party
 ||kipnobwbyz.bid^$third-party
+||kiqsynap.com^$third-party
 ||kisvtclf.bid^$third-party
 ||kizpkvkdfm.bid^$third-party
 ||kjabglumgwbsvq.bid^$third-party
 ||kjbfpptjlhxh.com^$third-party
 ||kjbqzbiteubt.com^$third-party
+||kjhdoend.com^$third-party
+||kjizuuuvqbcd.com^$third-party
 ||kjjlucebvxtu.com^$third-party
 ||kjkdagfnjm.bid^$third-party
 ||kjkwrmwdyhi.com^$third-party
@@ -42522,10 +41353,15 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||kjnkmidieyrb.com^$third-party
 ||kjplmlvtdoaf.com^$third-party
 ||kjqyvgvvazii.com^$third-party
+||kjsedplonmifbe.com^$third-party
+||kjtcdiyzd.com^$third-party
 ||kkawxvjeluwc.com^$third-party
 ||kknvwhcmqoet.com^$third-party
 ||kknwvfdzyqzj.com^$third-party
+||kkscoephxrum.com^$third-party
+||kksoyysmpp.com^$third-party
 ||kkvsvznavqkl.bid^$third-party
+||kkxrizpdh.com^$third-party
 ||kkztcmjvklinxp.bid^$third-party
 ||klakcdiqmgxq.com^$third-party
 ||kldwitfrqwal.com^$third-party
@@ -42533,16 +41369,22 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||kleonsqapa.bid^$third-party
 ||klepuazuxv.com^$third-party
 ||klfqffhvdpkd.com^$third-party
+||klhjuuwrmxyjsn.com^$third-party
+||klhvqeajy.com^$third-party
 ||klidpcdzfqj.com^$third-party
 ||klmdwvqhi.com^$third-party
 ||klmfvshct.bid^$third-party
 ||klmvharqoxdq.com^$third-party
 ||klnbyxhdilss.bid^$third-party
+||klnzalfz.com^$third-party
 ||klprrjvqalwx.bid^$third-party
 ||klqnukgo.com^$third-party
 ||klrdsagmuepg.com^$third-party
 ||klsduixe.com^$third-party
 ||klurrmvbqrhrwc.com^$third-party
+||klxteeltivy.com^$third-party
+||klzvkrzluqnx.com^$third-party
+||kmalnsqvyygwe.com^$third-party
 ||kmcebwjulu.com^$third-party
 ||kmclwuukyffyjf.com^$third-party
 ||kmdqjdktf.bid^$third-party
@@ -42550,7 +41392,10 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||kmefggxf.bid^$third-party
 ||kmglqqaeqh.bid^$third-party
 ||kmiobghwsc.bid^$third-party
+||kmjexpirqstyzv.com^$third-party
+||kmkdkefa.com^$third-party
 ||kmkweqtfjw.com^$third-party
+||kmpcmafvqf.com^$third-party
 ||kmqlirdx.bid^$third-party
 ||kmtubsbmwdep.com^$third-party
 ||kmtyyvemtscac.com^$third-party
@@ -42559,14 +41404,24 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||kmveerigfvyy.com^$third-party
 ||kmvupiadkzdn.com^$third-party
 ||kmyelzmlkl.bid^$third-party
+||kmypiwpbastt.com^$third-party
+||knepsiwviviwed.com^$third-party
+||knimmqli.com^$third-party
 ||knkxnwscphdk.com^$third-party
+||knndhcnwv.com^$third-party
+||knnvmkbemftwgj.com^$third-party
 ||knoyiwlxahoh.bid^$third-party
+||knpbefvk.com^$third-party
+||knqjhdkndh.com^$third-party
 ||knqjqzziu.com^$third-party
 ||knslxwqgatnd.com^$third-party
 ||kntdzsua.bid^$third-party
+||knwfmpvtj.com^$third-party
 ||knxwoaewryxaxd.bid^$third-party
 ||knyqnoozhcvrkc.bid^$third-party
+||koamxmikmuhahc.com^$third-party
 ||kofeereb.com^$third-party
+||kojywvexdq.com^$third-party
 ||kokqhnybnhdr.bid^$third-party
 ||komfveajdx.bid^$third-party
 ||konbwfktusra.com^$third-party
@@ -42574,35 +41429,48 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||korocbbktnw.bid^$third-party
 ||kovglrrlpqum.com^$third-party
 ||kovykpybtuylq.bid^$third-party
+||kozloiczght.com^$third-party
 ||kpcflxxodhoxev.bid^$third-party
+||kpchywhqcrkz.com^$third-party
 ||kpgcyqkktm.bid^$third-party
+||kpgjogkbwjpmz.com^$third-party
+||kpjrmmfrxbrw.com^$third-party
 ||kplzvizvsqrh.com^$third-party
 ||kpnuqvpevotn.com^$third-party
+||kpoplhjnhlagy.com^$third-party
+||kprbvmfb.com^$third-party
 ||kprkrbatuob.com^$third-party
 ||kpsdnlprwclz.com^$third-party
 ||kpucctqryjdvx.bid^$third-party
 ||kpwhkeehpsp.bid^$third-party
+||kpwjtpgvowifq.com^$third-party
 ||kpzvcvclybfa.com^$third-party
 ||kqaqantjwn.bid^$third-party
 ||kqcflzvunhew.com^$third-party
 ||kqctdqqcjjsqrc.bid^$third-party
+||kqflgvrwqpzwue.com^$third-party
 ||kqgfcumsbtyy.com^$third-party
 ||kqkheakqrh.bid^$third-party
 ||kqlvuutpgdnude.com^$third-party
 ||kqmjmrzjhmdn.com^$third-party
+||kqohskoysgxx.com^$third-party
 ||kqsipdhvcejx.com^$third-party
 ||kqssmkxdtuc.bid^$third-party
 ||kquthdppub.com^$third-party
 ||kqvpjbau.com^$third-party
 ||kqyckxlnll.bid^$third-party
+||krdvzahyr.com^$third-party
 ||krezqajxv.bid^$third-party
 ||krghheqkkcght.com^$third-party
 ||krgxtloi.bid^$third-party
 ||krilxjkgttmp.com^$third-party
 ||krmuxxubtkrg.com^$third-party
 ||krovrhmqgupd.com^$third-party
+||krpdqnnb.com^$third-party
 ||krrmpgdmoexc.club^$third-party
 ||krsdoqvsmgld.com^$third-party
+||krtdobasy.com^$third-party
+||krtpkaha.com^$third-party
 ||krxexwfnghfu.com^$third-party
 ||krxpudrzyvko.com^$third-party
 ||krynjumnqlix.com^$third-party
@@ -42613,34 +41481,49 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||ksavfuxjbqx.com^$third-party
 ||ksbewtjuqitxg.bid^$third-party
 ||ksbklucaxgbf.com^$third-party
+||ksevfixrkqdx.com^$third-party
 ||ksevqmggaxtxt.bid^$third-party
 ||kshysnypina.com^$third-party
+||ksihafqopndbq.com^$third-party
 ||ksioijtb.com^$third-party
 ||ksjjpsjymdekyr.bid^$third-party
 ||kslgvaexlw.com^$third-party
 ||ksloibpah.com^$third-party
+||ksrcnyrntlyfo.com^$third-party
+||ksufusxqd.com^$third-party
+||ksukpuyqs.com^$third-party
 ||ksveztrxudtt.com^$third-party
 ||ksxaaoey.bid^$third-party
 ||ktbcsulyildmm.com^$third-party
 ||ktcltsgjcbjdcyrcdaspmwqwscxgbqhscmkpsxarejfsfpohkk.com^$third-party
+||ktdthraxzxt.com^$third-party
 ||ktexnnvlvhxa.com^$third-party
+||ktfjyexcacujjg.com^$third-party
+||ktgndscphrtxi.com^$third-party
 ||ktgsiqgj.bid^$third-party
 ||kthdreplfmil.com^$third-party
 ||kthwboouxxcmc.bid^$third-party
 ||kthztsgfuygcw.com^$third-party
+||ktjcrhdppesdd.com^$third-party
 ||ktjqfqadgmxh.com^$third-party
 ||ktrgcpceilj.com^$third-party
 ||ktrmzzrlkbet.com^$third-party
+||ktteklov.com^$third-party
 ||kttjowlrr.com^$third-party
 ||ktuiyrchrhuxn.bid^$third-party
+||ktzwdewsckssid.com^$third-party
 ||kuavzcushxyd.com^$third-party
 ||kuaygqohsbeg.com^$third-party
+||kubichpbtjdvo.com^$third-party
 ||kubmcyofaeu.com^$third-party
 ||kuhbcpckauwt.bid^$third-party
 ||kuhlorflbeq.com^$third-party
 ||kujfhmyoeemqxb.bid^$third-party
 ||kujkgfzzyeol.com^$third-party
+||kujwlsnl.com^$third-party
 ||kumekqeccmob.com^$third-party
+||kumjidmumktzq.com^$third-party
+||kumtwckyq.com^$third-party
 ||kunkmdvgwvfo.bid^$third-party
 ||kuplohinctdwk.com^$third-party
 ||kupprakim.bid^$third-party
@@ -42651,17 +41534,25 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||kuqylnamtv.bid^$third-party
 ||kurtgcwrdakv.com^$third-party
 ||kutlvuitevgw.com^$third-party
+||kuvlikgekekwp.com^$third-party
+||kuwlmrggxrznky.com^$third-party
 ||kuwogsiplp.com^$third-party
 ||kuwzhgbnygarx.com^$third-party
 ||kvadaiwjwxdp.com^$third-party
 ||kvajiszer.bid^$third-party
 ||kvcymnoxr.com^$third-party
+||kvdguzclhatdul.com^$third-party
+||kvdjcnerhxzb.com^$third-party
 ||kvfdhsmrrwamt.bid^$third-party
+||kvflzevaaco.com^$third-party
 ||kvgtjwduvn.bid^$third-party
 ||kvhkfptcv.bid^$third-party
+||kvhxckkd.com^$third-party
 ||kvikjeqepjrq.bid^$third-party
+||kvjbqtwgrfnmt.com^$third-party
 ||kvkoqywl.com^$third-party
 ||kvmsbpzptwm.bid^$third-party
+||kvnldhrlw.com^$third-party
 ||kvootrjvinkuae.bid^$third-party
 ||kvpofpkxmlpb.com^$third-party
 ||kvprhbqnmszru.com^$third-party
@@ -42673,37 +41564,53 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||kvvvdfimdxnu.com^$third-party
 ||kvwvhpthqyaxk.bid^$third-party
 ||kvzvtiswjroe.com^$third-party
+||kwajysvvjeyvs.com^$third-party
 ||kwcaatayhgkq.bid^$third-party
+||kwcrryneebg.com^$third-party
+||kweayxzfazrws.com^$third-party
+||kwflzktzaxczm.com^$third-party
 ||kwgpddeduvje.com^$third-party
 ||kwiaofifmdqpif.com^$third-party
 ||kwipnlppnybc.com^$third-party
 ||kwjglwybtlhm.com^$third-party
+||kwkxvbjz.com^$third-party
+||kwomkjjoajcyyt.com^$third-party
 ||kwovwwkevyu.bid^$third-party
 ||kwshmdfgijgu.com^$third-party
+||kwsmqtposrub.com^$third-party
 ||kwspcwwjju.com^$third-party
 ||kwuaiymxezji.bid^$third-party
 ||kwuewixsnttz.com^$third-party
 ||kwunqjqntrnf.bid^$third-party
 ||kwvoafkdebdaxz.bid^$third-party
+||kwygntce.com^$third-party
+||kwykvodkvg.com^$third-party
 ||kwystoaqjvml.com^$third-party
 ||kwyxncikkzz.bid^$third-party
 ||kwzuhmpwvsbsc.bid^$third-party
 ||kxareafqwjop.com^$third-party
 ||kxdprqrrfhhn.com^$third-party
+||kxemsltfmm.com^$third-party
 ||kxhnlmrnqw.bid^$third-party
 ||kxjzvfrhyf.com^$third-party
+||kxkeuums.com^$third-party
 ||kxldvncqrkv.com^$third-party
 ||kxounmvfkmvv.com^$third-party
 ||kxphhdia.bid^$third-party
+||kxpkadaivbm.com^$third-party
 ||kxtepdregiuo.com^$third-party
 ||kxtkfkqkrzz.bid^$third-party
 ||kxujlopfsmttyc.com^$third-party
 ||kxwkbkfespyh.com^$third-party
 ||kxwuskjg.bid^$third-party
 ||kxyevjvmalerq.bid^$third-party
+||kxzmmtdx.com^$third-party
 ||kyckfuuzdzmsv.bid^$third-party
+||kycsebgx.com^$third-party
 ||kyegtutis.bid^$third-party
+||kyelvsyayysa.com^$third-party
 ||kyfekvgsyraz.bid^$third-party
+||kygozmlrr.com^$third-party
 ||kyhkyreweusn.com^$third-party
 ||kyieflmhiekvrr.bid^$third-party
 ||kylbshaqo.bid^$third-party
@@ -42719,53 +41626,84 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||kyzlzjtbgjr.bid^$third-party
 ||kzawrekf.bid^$third-party
 ||kzexkhstcng.com^$third-party
+||kzfinsoee.com^$third-party
 ||kzgzfndrvpnz.com^$third-party
+||kzlmwsyftm.com^$third-party
 ||kzqrjfulybvv.com^$third-party
 ||kzujizavnlxf.com^$third-party
 ||kzwcmbypauw.com^$third-party
 ||kzwddxlpcqww.com^$third-party
 ||kzyiepouyib.bid^$third-party
 ||kzzqkhxjeytu.com^$third-party
+||labdwkqyavb.com^$third-party
 ||lacrxqvydzlan.bid^$third-party
 ||ladhyjqqgerr.com^$third-party
 ||lafvopkskbeuj.bid^$third-party
+||lajpmujdntg.com^$third-party
+||lalywprgzl.com^$third-party
+||lamwiadakwa.com^$third-party
+||lanktydm.com^$third-party
 ||lapbekessbozpx.bid^$third-party
 ||laqiccblmxfewa.bid^$third-party
 ||lauzlpyl.com^$third-party
 ||lavmeebdxwc.com^$third-party
+||lawbjcjsokmua.com^$third-party
+||lawvcpqtapzsh.com^$third-party
 ||lazkslkkmtpy.com^$third-party
+||lbaybxwiklnfe.com^$third-party
 ||lbbfzsjmgm.com^$third-party
 ||lbbgjozyrgy.com^$third-party
 ||lbdrnmkhwgkpdg.bid^$third-party
 ||lbfryfttoihl.com^$third-party
+||lbgmmsubsxn.com^$third-party
 ||lbjgdskmgsmowy.com^$third-party
+||lbkprcoosfgk.com^$third-party
 ||lbpndcvhuqlm.com^$third-party
 ||lbtcymxcocwh.bid^$third-party
 ||lbtifiprfzy.com^$third-party
+||lburmovcjefv.com^$third-party
 ||lbypppwfvagq.com^$third-party
 ||lbytagcqxefsn.com^$third-party
 ||lceihiuarfqbn.bid^$third-party
 ||lckpubqq.com^$third-party
+||lckzoepctj.com^$third-party
+||lcmkcvisyynkw.com^$third-party
 ||lcmwchhybzik.bid^$third-party
 ||lcnvxuipvq.bid^$third-party
+||lcolevwciuwj.com^$third-party
 ||lcpqoewrzuxh.com^$third-party
+||lcqnkwcfwrkvh.com^$third-party
 ||lcrdolxjoxxlr.com^$third-party
+||lcsgdwlxrlgq.com^$third-party
 ||lctpaemybjkv.com^$third-party
+||lcttjawsbwol.com^$third-party
 ||lcuprkufusba.com^$third-party
+||lcvofuqxovcao.com^$third-party
 ||lcxrhcqouqtw.com^$third-party
+||lcxrimmb.com^$third-party
 ||lcyncwbacrgz.com^$third-party
 ||lcyxmuhxroyo.com^$third-party
 ||ldaiuhkayqtu.com^$third-party
 ||ldbgrugl.bid^$third-party
+||ldgananrrtx.com^$third-party
 ||ldigvkkjquvyn.com^$third-party
 ||ldkyzudgbksh.com^$third-party
 ||ldlritslfej.bid^$third-party
+||ldqxdxtkepveg.com^$third-party
+||lduusuiclvw.com^$third-party
+||ldvfvwkjtacrfm.com^$third-party
+||ldvmpopwd.com^$third-party
+||ldxdpitoeox.com^$third-party
 ||ldybupeeeoq.bid^$third-party
 ||ldyiuvdoahxz.com^$third-party
 ||lebeiivzmm.com^$third-party
+||lebqrivt.com^$third-party
 ||lebskmaewbhm.bid^$third-party
+||ledvqaldtf.com^$third-party
 ||lepyhlczldiuja.bid^$third-party
+||lesmyjzc.com^$third-party
 ||lestujzrpeom.bid^$third-party
+||leszvphhnytpk.com^$third-party
 ||leuojmgbkpcl.com^$third-party
 ||levjirsqbtjhif.bid^$third-party
 ||lexcyehlniruu.bid^$third-party
@@ -42774,7 +41712,11 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||lfcnzhcnzded.com^$third-party
 ||lffyoomtjjhvc.com^$third-party
 ||lfirckcbkh.com^$third-party
+||lfjmmgorkjoaw.com^$third-party
+||lfjvaaswkxqj.com^$third-party
 ||lflplmckcncj.com^$third-party
+||lfqocbhv.com^$third-party
+||lfrqmuplp.com^$third-party
 ||lfshijqwdei.bid^$third-party
 ||lftyfcqqctj.com^$third-party
 ||lfvrjrdrgazl.com^$third-party
@@ -42782,7 +41724,10 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||lfzbgckyctztj.bid^$third-party
 ||lgbpcbddfs.bid^$third-party
 ||lgbshazoug.com^$third-party
+||lghrdwdl.com^$third-party
 ||lgisbsiocy.bid^$third-party
+||lgjboylszpij.com^$third-party
+||lgjqgatg.com^$third-party
 ||lgkzfskybz.com^$third-party
 ||lgkzmjfu.bid^$third-party
 ||lgnjcntegeqf.com^$third-party
@@ -42791,41 +41736,63 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||lgtbcaqkjo.bid^$third-party
 ||lgthvsytzwtc.com^$third-party
 ||lgtnwgfqkyyf.com^$third-party
+||lgzfhqubp.com^$third-party
+||lgzjsauvfv.com^$third-party
 ||lhapwjkoltogf.bid^$third-party
 ||lhaqzqjbafcu.com^$third-party
 ||lhbkkztxg.com^$third-party
+||lhdndgmsy.com^$third-party
+||lheanhxv.com^$third-party
 ||lhedywrtanrgz.bid^$third-party
 ||lhekiqlzatfv.com^$third-party
+||lheqossp.com^$third-party
 ||lhfcddgwg.bid^$third-party
 ||lhhrhdlankdftk.com^$third-party
+||lhjisbsegvxf.com^$third-party
+||lhltebxyuzjt.com^$third-party
 ||lhmnbgieieksdv.bid^$third-party
 ||lhnlplsj.bid^$third-party
 ||lhqcrrsatxwsl.bid^$third-party
+||lhtekmhy.com^$third-party
 ||lhttyvdxvgjrdp.com^$third-party
+||lhtvkhelii.com^$third-party
+||lhuetsviudr.com^$third-party
 ||lhuqalcxjmtq.com^$third-party
 ||lhxgdmcyropacl.bid^$third-party
+||lhytmylpwfzuzm.com^$third-party
+||liadlzantv.com^$third-party
 ||liakiadlbs.com^$third-party
 ||licoxbkagivaf.bid^$third-party
+||liesiotlpfvjm.com^$third-party
 ||ligabklr.com^$third-party
 ||liilsuive.bid^$third-party
 ||lijddbusldnecz.bid^$third-party
 ||lilncsqapikckt.com^$third-party
 ||liosawitskzd.com^$third-party
 ||liqbipkfbafq.com^$third-party
+||liuduuct.com^$third-party
+||liulwxrybupyzu.com^$third-party
 ||liuztvaem.bid^$third-party
+||livvckublf.com^$third-party
 ||livxcgmpvz.bid^$third-party
 ||liwimgti.bid^$third-party
 ||lixzmpxjilqp.com^$third-party
+||ljactjfsjs.com^$third-party
 ||ljavtgsvjpxm.bid^$third-party
 ||ljfetlhleiffr.bid^$third-party
 ||ljfmxgkfmvtowg.com^$third-party
 ||ljgmufobaphrd.com^$third-party
 ||ljhuvzutnpza.com^$third-party
+||ljhyotgxuyglm.com^$third-party
+||ljjaiargqfwtzu.com^$third-party
+||ljkihuolgoh.com^$third-party
+||ljkmwpvahv.com^$third-party
 ||ljmgkopyodih.bid^$third-party
 ||ljngencgbdbn.com^$third-party
 ||ljngjrwkyovx.com^$third-party
 ||ljpuptlitl.com^$third-party
 ||ljqozvzjphgbw.bid^$third-party
+||ljrljohnoqa.com^$third-party
 ||ljvgxanxkuiw.com^$third-party
 ||ljwbfghcggfvv.com^$third-party
 ||ljyncrypt.bid^$third-party
@@ -42837,50 +41804,88 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||lkfepwhchrlv.bid^$third-party
 ||lkfuihubbros.com^$third-party
 ||lkgcdedbklfse.com^$third-party
+||lkhkeviyctneka.com^$third-party
 ||lkjmcevfgoxfbyhhmzambtzydolhmeelgkotdllwtfshrkhrev.com^$third-party
+||lkksbzcslmeefw.com^$third-party
 ||lkktkgcpqzwd.com^$third-party
+||lkmoqyzfv.com^$third-party
+||lknxarjfidm.com^$third-party
+||lkohqfilvpked.com^$third-party
+||lkojwhiwcsum.com^$third-party
 ||lkrcapch.com^$third-party
+||lkuirehx.com^$third-party
+||lkzvhtetshbu.com^$third-party
 ||llbevorurncfcc.bid^$third-party
 ||llbynwyuoj.bid^$third-party
 ||llddarkinywtmg.bid^$third-party
+||llgvjtkg.com^$third-party
+||llhjbwcjnuii.com^$third-party
+||lliumrpvj.com^$third-party
+||lljoapkfnwn.com^$third-party
 ||lljtgiwhqtue.com^$third-party
 ||llluzqrvfyrbt.com^$third-party
 ||llnxfuxszevf.com^$third-party
+||llpdtbmowsg.com^$third-party
+||llpuhxkvr.com^$third-party
+||llrblpesvjc.com^$third-party
 ||llrmbabwjlzutw.com^$third-party
 ||llrxxhljtmylaa.bid^$third-party
+||llsdercqm.com^$third-party
+||llvidwpt.com^$third-party
 ||llwemrshzovw.com^$third-party
 ||llxyamztns.bid^$third-party
 ||llxyyocfgfg.bid^$third-party
 ||lmbdkdxprktt.bid^$third-party
+||lmccawemcuqma.com^$third-party
+||lmcoiiwpguaorp.com^$third-party
 ||lmejuamdbtwc.com^$third-party
+||lmepqfsazb.com^$third-party
+||lmevacaixeqy.com^$third-party
 ||lmheosvft.com^$third-party
 ||lmjjenhdubpu.com^$third-party
 ||lmjklpukbbwxm.bid^$third-party
 ||lmjpcirfvt.bid^$third-party
+||lmjxrhph.com^$third-party
+||lmlvzeeag.com^$third-party
 ||lmoqmsagyjcurg.bid^$third-party
+||lmsycyfh.com^$third-party
 ||lmuxaeyapbqxszavtsljaqvmlsuuvifznvttuuqfcxcbgqdnn.com^$third-party
 ||lmwdcdzievq.bid^$third-party
 ||lndvtedtayqy.com^$third-party
 ||lndzkpjtjfjz.bid^$third-party
 ||lnelcbntwru.com^$third-party
+||lnfujzqkydjav.com^$third-party
 ||lnglwoexxrsv.com^$third-party
+||lnicyniqxdxg.com^$third-party
 ||lnjpyxvbpyvj.com^$third-party
 ||lnjrawgb.com^$third-party
 ||lnltyqqop.bid^$third-party
 ||lnnwwxpeodmw.com^$third-party
+||lnpqqigowz.com^$third-party
 ||lnsthqzdsvzboo.bid^$third-party
+||lnwbiuetoymifj.com^$third-party
+||lnwqvhcqw.com^$third-party
 ||lnzcmgguxlac.com^$third-party
 ||loakfiiggz.bid^$third-party
 ||locjzfoh.com^$third-party
 ||lofipgeld.bid^$third-party
+||logkzudhrg.com^$third-party
+||lohxvwjpvl.com^$third-party
 ||lojqfrcipvoo.bid^$third-party
+||lojuxbnt.com^$third-party
 ||loljuduad.bid^$third-party
 ||lopdogmltbnbc.com^$third-party
 ||lorhamnvukws.bid^$third-party
 ||lorpidlfpbu.bid^$third-party
+||loteumepag.com^$third-party
 ||lovdkmqvoc.bid^$third-party
+||lovnxkrszlsb.com^$third-party
+||lovvznyhujf.com^$third-party
 ||lowqnzsxtmvb.bid^$third-party
 ||loxmetwdjrmh.com^$third-party
+||lpbhbwpbpnl.com^$third-party
+||lpbuaqfgwkzrep.com^$third-party
+||lpbyadpvf.com^$third-party
 ||lpdeuhyakoits.bid^$third-party
 ||lpiqwtsuduhh.com^$third-party
 ||lplqyocxmify.com^$third-party
@@ -42889,9 +41894,14 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||lppaepra.bid^$third-party
 ||lppoblhorbrf.com^$third-party
 ||lppyumumznf.bid^$third-party
+||lprkphlgaybvtn.com^$third-party
+||lptggobhuuxcdw.com^$third-party
 ||lpwvdgfo.com^$third-party
+||lpxxafsupgsho.com^$third-party
 ||lpzltglosmbqul.bid^$third-party
+||lpzsxemf.com^$third-party
 ||lqaqfklrgnr.bid^$third-party
+||lqbyqjap.com^$third-party
 ||lqdrlzunrgma.bid^$third-party
 ||lqfbxvmq.bid^$third-party
 ||lqfolelqvc.com^$third-party
@@ -42907,6 +41917,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||lqrrkjodhq.com^$third-party
 ||lqsclyxh.bid^$third-party
 ||lqtxnuramh.bid^$third-party
+||lquodkeqws.com^$third-party
 ||lqvckaciozvs.bid^$third-party
 ||lqvmjokehnlffq.bid^$third-party
 ||lqvuvkmohlktl.bid^$third-party
@@ -42916,39 +41927,51 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||lrcnshyxwx.bid^$third-party
 ||lrcrobshelr.com^$third-party
 ||lreylxggpqxz.bid^$third-party
+||lrgtkljakwfw.com^$third-party
 ||lrjltdosshhd.com^$third-party
 ||lrmjvytlhho.com^$third-party
 ||lrnkuzcezcdn.bid^$third-party
 ||lroieivnhoojo.bid^$third-party
 ||lroywnhohfrj.com^$third-party
 ||lrpcokbf.bid^$third-party
+||lruyzrlcef.com^$third-party
 ||lrwwnmijztt.com^$third-party
 ||lryenoty.bid^$third-party
+||lsdgtifuqrwjax.com^$third-party
 ||lsegvhvzrpqc.com^$third-party
 ||lsghawrw.bid^$third-party
 ||lsgystgg.bid^$third-party
 ||lshwezesshks.com^$third-party
 ||lskzcjgerhzn.com^$third-party
+||lsmxicydlj.com^$third-party
+||lsooyivois.com^$third-party
+||lsovdlxfe.com^$third-party
 ||lsslotuojpud.com^$third-party
+||lstkchbeoey.com^$third-party
 ||lstkfdmmxbmv.com^$third-party
 ||ltaporjivped.com^$third-party
+||ltbnvsfzevox.com^$third-party
 ||ltcvpgyouvxya.bid^$third-party
 ||ltedbswmryh.com^$third-party
 ||ltendtxpnss.bid^$third-party
 ||ltffxzmjazabn.bid^$third-party
 ||ltfroezjyyhv.com^$third-party
+||ltfxlxze.com^$third-party
+||ltjvgpxg.com^$third-party
 ||ltmdqbrxjaqn.bid^$third-party
 ||ltnfhltuksarpq.com^$third-party
 ||ltnjtphbbvigi.bid^$third-party
 ||ltsdzcgcystyak.bid^$third-party
 ||ltsnideak.bid^$third-party
 ||lttsvesujmry.com^$third-party
+||ltvrdftgr.com^$third-party
 ||ltwlxoedrydz.com^$third-party
 ||ltxltqtwpj.bid^$third-party
 ||ltzjkjxx.com^$third-party
 ||lubjqiebnayctz.bid^$third-party
 ||ludwmwca.bid^$third-party
 ||lugknllg.bid^$third-party
+||luhbhndh.com^$third-party
 ||luhqeqaypvmc.com^$third-party
 ||luihhjhe.bid^$third-party
 ||lujkgrvheh.com^$third-party
@@ -42956,110 +41979,177 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||lunkydkokpg.bid^$third-party
 ||luqnpzexna.bid^$third-party
 ||luraclhaunxv.com^$third-party
+||lusfrsxgxopm.com^$third-party
 ||luvkkodlpxou.bid^$third-party
 ||luvstnqpw.com^$third-party
 ||luztinhsbzggvr.com^$third-party
 ||lvayccwmhdggvi.bid^$third-party
+||lvcrcimfmfx.com^$third-party
+||lvctzafuvn.com^$third-party
 ||lvcxvjetzvt.com^$third-party
 ||lvdtftxgbsiu.com^$third-party
 ||lvehrzkgzanurn.com^$third-party
+||lvesmhsex.com^$third-party
+||lvgliqkumatjv.com^$third-party
 ||lvhxebdxz.com^$third-party
+||lvldcxnq.com^$third-party
 ||lvlotqtrygwi.com^$third-party
 ||lvlvpdztdnro.com^$third-party
+||lvmnxohz.com^$third-party
 ||lvpcqndtdk.bid^$third-party
 ||lvpdchbxgoral.bid^$third-party
 ||lvrvufurxhgp.com^$third-party
 ||lvshypqdjfvvkd.com^$third-party
 ||lvulibji.com^$third-party
+||lvvfcuzzdor.com^$third-party
+||lvvycndnspeuwo.com^$third-party
+||lwajqohv.com^$third-party
 ||lwaqcpjegbwm.com^$third-party
 ||lwasxldakmhx.com^$third-party
 ||lwbextsnjgw.com^$third-party
 ||lwenrqtarmdx.com^$third-party
 ||lwepsxhcm.bid^$third-party
+||lwequndmgc.com^$third-party
+||lwfvrhlqzjseyu.com^$third-party
 ||lwjzsigenxsl.com^$third-party
 ||lwljmcved.bid^$third-party
 ||lwmxykibvt.bid^$third-party
 ||lwnpbwds.bid^$third-party
 ||lwocvazxfnuj.com^$third-party
 ||lwqwsptepdxy.com^$third-party
+||lwtduavwbep.com^$third-party
 ||lwtsrwwlfd.com^$third-party
 ||lwvdeqfhswg.com^$third-party
 ||lwxkgejswn.com^$third-party
 ||lwyjxvbcjkstxy.com^$third-party
 ||lwysswaxnutn.com^$third-party
+||lxayafcq.com^$third-party
 ||lxbaocqsmg.bid^$third-party
 ||lxcfaekywx.com^$third-party
+||lxcpbfwqagzfz.com^$third-party
+||lxcpprjfgkt.com^$third-party
+||lxelgoqzvjfw.com^$third-party
 ||lxghhxdcmumk.com^$third-party
 ||lxkqybzanzug.com^$third-party
+||lxlisrvzz.com^$third-party
+||lxnimmyikuekn.com^$third-party
+||lxpgdkskkt.com^$third-party
 ||lxqoxgijpbmrg.bid^$third-party
 ||lxvuwsqp.bid^$third-party
+||lxwtezlcp.com^$third-party
+||lxyadcffdpaytd.com^$third-party
 ||lxyjnqpbk.bid^$third-party
+||lxymfyptdrast.com^$third-party
+||lxzwknybfvycxr.com^$third-party
+||lybmmxah.com^$third-party
+||lydgyhthfb.com^$third-party
 ||lyeannqhhf.bid^$third-party
+||lyghoxyxohkrdk.com^$third-party
 ||lyifwfhdizcc.com^$third-party
 ||lyjcpycaufud.com^$third-party
+||lykuxkxsvvnxqd.com^$third-party
+||lynsvdabds.com^$third-party
 ||lyovvtevsu.bid^$third-party
+||lyssmgbr.com^$third-party
 ||lytaxbxen.bid^$third-party
 ||lytpdzqyiygthvxlmgblonknzrctcwsjycmlcczifxbkquknsr.com^$third-party
 ||lyuoaxruaqdo.com^$third-party
 ||lyuswpdanr.com^$third-party
 ||lyvnduow.bid^$third-party
+||lyyenjcocog.com^$third-party
 ||lyygeitghavmm.com^$third-party
 ||lyzskjigkxwy.com^$third-party
 ||lzawbiclvehu.com^$third-party
 ||lzblbcsemihk.com^$third-party
 ||lzbzwpmozwfy.com^$third-party
 ||lzfvonzwjzhz.com^$third-party
+||lzkuqbptcjqta.com^$third-party
 ||lzmovatu.com^$third-party
+||lzopoqzlihfbc.com^$third-party
 ||lzpqpstowpvz.bid^$third-party
 ||lzrfxzvfbkay.com^$third-party
+||lzscunjyovitc.com^$third-party
 ||lzsiojww.com^$third-party
 ||lzvnaaozpqyb.com^$third-party
 ||maboflgkaxqn.com^$third-party
 ||mafndqbvdgkm.com^$third-party
 ||magwfymjhils.com^$third-party
+||maidlytsnrn.com^$third-party
+||mailhxubk.com^$third-party
 ||makhhvgdkhwn.com^$third-party
+||makumuvgxfogq.com^$third-party
 ||malgyhuytbnjb.bid^$third-party
 ||mardjxrw.club^$third-party
+||marguvpydbrr.com^$third-party
+||mascqybw.com^$third-party
 ||masrtwfevkqd.bid^$third-party
+||maudfkdsuyp.com^$third-party
 ||mavmlkzt.com^$third-party
 ||mawtykynmhxkjd.bid^$third-party
 ||maxgirlgames.com^$third-party
+||maysrqdev.com^$third-party
 ||maziynjxjdoe.com^$third-party
 ||mbajaazbqdzc.com^$third-party
+||mbbjrwsl.com^$third-party
 ||mbezfrwrimjy.bid^$third-party
 ||mbflncteg.bid^$third-party
 ||mbfvfdkawpoi.com^$third-party
 ||mbgvhfotcqsj.com^$third-party
+||mbixofultnnd.com^$third-party
+||mbmjqinvsil.com^$third-party
+||mbmwfufkaxll.com^$third-party
 ||mbrxgolis.com^$third-party
+||mbsivmsbuteaz.com^$third-party
 ||mbtalhkebpbpwb.com^$third-party
 ||mbvmecdlwlts.com^$third-party
 ||mbyponflbv.bid^$third-party
+||mbyrgeoizdid.com^$third-party
 ||mcagbtdcwklf.com^$third-party
+||mcaxqvcu.com^$third-party
+||mcaybfrnrqpmv.com^$third-party
+||mcfdnvewqws.com^$third-party
+||mcgndenytmy.com^$third-party
+||mchpowtyj.com^$third-party
+||mcirxbajhw.com^$third-party
 ||mciyblxplucm.bid^$third-party
+||mcjdsooo.com^$third-party
 ||mclwrdzj.bid^$third-party
+||mcnklvsodqqa.com^$third-party
 ||mcrjoftwhprkrx.bid^$third-party
+||mcsnhbdil.com^$third-party
+||mcuqjebym.com^$third-party
 ||mcvyeitc.com^$third-party
 ||mcwvyuifwml.bid^$third-party
+||mcyopesbusomqf.com^$third-party
+||mczemvlzkndplq.com^$third-party
 ||mczuljmdpysftg.com^$third-party
 ||mdagsecyvd.com^$third-party
 ||mdbdmbdrjaklht.bid^$third-party
 ||mddlhkzkntmmb.com^$third-party
 ||mddviuqbkwyir.bid^$third-party
 ||mdeaoowvqxma.com^$third-party
+||mdgpupricqpmy.com^$third-party
 ||mdgupvvdjpafyl.bid^$third-party
 ||mdjtqsamfeodp.bid^$third-party
+||mdlhzknv.com^$third-party
 ||mdpjnppsbjv.bid^$third-party
+||mdpmgoitzaotk.com^$third-party
 ||mdrkqbsirbry.com^$third-party
 ||mdsrggcnmybae.bid^$third-party
+||mdulmrphzsnvw.com^$third-party
+||mdurqeiydegwzy.com^$third-party
 ||mdvrxmzofurvkm.com^$third-party
 ||meagjivconqt.com^$third-party
 ||mecounxmawn.bid^$third-party
 ||mecsjjkomehyv.com^$third-party
 ||medyagundem.com^$third-party
 ||meeaowsxneps.com^$third-party
+||mefozykpcwuazw.com^$third-party
 ||megpacokjce.bid^$third-party
+||meguanha.com^$third-party
 ||mehcpazsnzh.com^$third-party
 ||mekmrcgtmuvv.bid^$third-party
+||melfljypjydxta.com^$third-party
 ||melqdjqiekcv.com^$third-party
 ||menjyhvs.bid^$third-party
 ||mepchnbjsrik.com^$third-party
@@ -43067,9 +42157,12 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||meuxestvodec.bid^$third-party
 ||mexedyfzdx.bid^$third-party
 ||mezihrnjuc.com^$third-party
+||mfdhvdwkdg.com^$third-party
 ||mfdmsmndqarhb.bid^$third-party
 ||mfeoaesafo.com^$third-party
 ||mffurrpzbum.com^$third-party
+||mfgyyqqjpp.com^$third-party
+||mfigasff.com^$third-party
 ||mfiksyuanw.bid^$third-party
 ||mfjegjqb.com^$third-party
 ||mflkgrgxadij.com^$third-party
@@ -43080,19 +42173,32 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||mftbfgcusnzl.com^$third-party
 ||mfuebmooizdr.com^$third-party
 ||mfvirwqgmck.bid^$third-party
+||mfwfpucpfya.com^$third-party
+||mfxjgymma.com^$third-party
+||mfxxpyhzofbsg.com^$third-party
 ||mgjoqdmjofl.bid^$third-party
+||mgojnezwuuxyv.com^$third-party
+||mgouoirpayddk.com^$third-party
+||mgpejafvxxn.com^$third-party
 ||mgrutivnzs.com^$third-party
 ||mgrxsztbcfeg.com^$third-party
+||mguqjbjgs.com^$third-party
 ||mguzayfzp.bid^$third-party
 ||mgwebjwpcla.bid^$third-party
+||mgxjvidt.com^$third-party
 ||mgykxgrllcj.com^$third-party
+||mgyovgqq.com^$third-party
+||mgziozplbkzv.com^$third-party
 ||mhaafkoekzax.com^$third-party
 ||mhbfahukhp.bid^$third-party
 ||mhcttlcbkwvp.com^$third-party
+||mhfivsdhbpfgk.com^$third-party
 ||mhfvtafbraql.com^$third-party
 ||mhghzpotwnoh.com^$third-party
 ||mhglrnhcei.com^$third-party
+||mhhjdlsnji.com^$third-party
 ||mhhumeppcngjih.bid^$third-party
+||mhmgeilfkcgov.com^$third-party
 ||mhprjkdh.bid^$third-party
 ||mhqrhqwjiuylom.bid^$third-party
 ||mhrfhwlqsnzf.com^$third-party
@@ -43112,12 +42218,17 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||miltqbfqstsf.com^$third-party
 ||milyolpn.bid^$third-party
 ||miovsibmkpy.com^$third-party
+||mioxtidzcrh.com^$third-party
 ||miszwaojrn.com^$third-party
+||mivrpcxlo.com^$third-party
+||miwhonjam.com^$third-party
 ||mixfyfriqtatz.bid^$third-party
 ||mizmhwicqhprznhflygfnymqbmvwokewzlmymmvjodqlizwlrf.com^$third-party
 ||mjckfsgogzcd.com^$third-party
 ||mjlkhnizufhmrt.bid^$third-party
+||mjquyspsrgybs.com^$third-party
 ||mjujcjfrgslf.com^$third-party
+||mkalruavzrtmh.com^$third-party
 ||mkattqhvcikx.bid^$third-party
 ||mkbbocznt.bid^$third-party
 ||mkbfikaa.bid^$third-party
@@ -43127,18 +42238,23 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||mkgtdofakiifqb.bid^$third-party
 ||mkjcjqcn.com^$third-party
 ||mkkappfdehkwf.com^$third-party
+||mkkosxvmn.com^$third-party
 ||mkkxiztluu.com^$third-party
 ||mklplkwniazaql.bid^$third-party
 ||mkmxovjaijti.com^$third-party
 ||mkpdquuxcnhl.com^$third-party
 ||mkqepsxaz.bid^$third-party
+||mkxgvmswfmypy.com^$third-party
 ||mkyzqyfschwd.com^$third-party
+||mkzbpsiml.com^$third-party
 ||mkzllhqhsgq.com^$third-party
 ||mkzynqxqlcxk.com^$third-party
 ||mlaxgqosoawc.com^$third-party
 ||mlbzafthbtsl.com^$third-party
+||mldsiekmhy.com^$third-party
 ||mlfvoqwjvbzy.bid^$third-party
 ||mlgrrqymdsyk.com^$third-party
+||mlgtlxyicweqn.com^$third-party
 ||mlhpclmaba.bid^$third-party
 ||mlkejhpgb.bid^$third-party
 ||mlkqusrmsfib.com^$third-party
@@ -43151,19 +42267,24 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||mlzqvrunjp.com^$third-party
 ||mmaigzevcfws.com^$third-party
 ||mmauckxrzh.com^$third-party
+||mmbfmlrd.com^$third-party
 ||mmcltttqfkbh.com^$third-party
 ||mmdcibihoimt.com^$third-party
 ||mmdifgneivng.com^$third-party
 ||mmeddgjhplqy.com^$third-party
 ||mmesheltljyi.com^$third-party
+||mmfvtvdqlwxyj.com^$third-party
 ||mmfzcakzcqn.bid^$third-party
 ||mmknsfgqxxsg.com^$third-party
 ||mmnridsrreyh.com^$third-party
 ||mmojdtejhgeg.com^$third-party
 ||mmoxoatieyam.bid^$third-party
+||mmpcqstnkcelx.com^$third-party
 ||mmqsbtpmdrib.bid^$third-party
+||mmsdewfvxhw.com^$third-party
 ||mmshbwtpx.com^$third-party
 ||mmvcmovwegkz.com^$third-party
+||mmxbgakffqemu.com^$third-party
 ||mmygcnboxlam.com^$third-party
 ||mmyhkkzddlcqtj.bid^$third-party
 ||mnanijqnse.com^$third-party
@@ -43180,13 +42301,18 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||mnvgyfpoir.bid^$third-party
 ||mnvjibhehv.com^$third-party
 ||mnyavixcddgx.com^$third-party
+||mnyawkpabrsv.com^$third-party
 ||mnzimonbovqs.com^$third-party
 ||moadlbgojatn.com^$third-party
 ||modkehkcihvzi.bid^$third-party
 ||mofrupteeuqnvc.bid^$third-party
 ||mofvrnbngcern.bid^$third-party
+||moginhstnxswt.com^$third-party
+||mogqlceldpwbxe.com^$third-party
 ||mogrbrydixdvmc.bid^$third-party
 ||mohcafpwpldi.com^$third-party
+||mojhasmpl.com^$third-party
+||moleagmeq.com^$third-party
 ||molqvpnnlmnb.com^$third-party
 ||monlscalmows.bid^$third-party
 ||mopvkjodhcwscyudzfqtjuwvpzpgzuwndtofzftbtpdfszeido.com^$third-party
@@ -43196,9 +42322,11 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||moxdmkdzvkgxow.bid^$third-party
 ||moxvufgh.com^$third-party
 ||moyeluljrail.com^$third-party
+||mpfzgidlxsqtyt.com^$third-party
 ||mpgflvbe.com^$third-party
 ||mphqfyhswko.bid^$third-party
 ||mpifsodagy.com^$third-party
+||mpjitqgyr.com^$third-party
 ||mplxbmgukmc.com^$third-party
 ||mpmdostmf.com^$third-party
 ||mpmfdpakljrv.bid^$third-party
@@ -43208,9 +42336,15 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||mpytdykvcdsg.com^$third-party
 ||mpzuzvqyuvbh.com^$third-party
 ||mqcnrhxdsbwr.com^$third-party
+||mqdznyotsam.com^$third-party
+||mqgvsxqc.com^$third-party
+||mqhjvfeiiucga.com^$third-party
 ||mqjfzzgcrupfh.com^$third-party
 ||mqlkcicnrgpntw.bid^$third-party
 ||mqmbbiadhb.bid^$third-party
+||mqnklgnucy.com^$third-party
+||mqobpsctcxnbi.com^$third-party
+||mqohsosljexz.com^$third-party
 ||mqphkzwlartq.com^$third-party
 ||mqpyllobxdrfiu.com^$third-party
 ||mquvqdhzgfyjl.com^$third-party
@@ -43222,32 +42356,47 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||mrdiehhk.bid^$third-party
 ||mrepqeyednht.club^$third-party
 ||mrfveznetjtp.com^$third-party
+||mrjzfzwey.com^$third-party
 ||mrkzgpbaapif.com^$third-party
 ||mrnbzzwjkusv.com^$third-party
 ||mrnrnyavzcatfv.com^$third-party
 ||mrqsuedzvrrt.com^$third-party
+||mrtehsag.com^$third-party
 ||mrutbjvgh.com^$third-party
 ||mruxsxrnu.com^$third-party
 ||mrvzisfsrvs.bid^$third-party
 ||mrweekseur.com^$third-party
 ||mrxvgpzath.bid^$third-party
+||mrzpfpgh.com^$third-party
 ||msbmckzmcu.com^$third-party
 ||msiegurhgfyl.com^$third-party
+||msigpurubzkm.com^$third-party
+||msisvvxmnpm.com^$third-party
 ||msjpmpumsf.bid^$third-party
+||msmaijsxlo.com^$third-party
 ||msmyjmkshh.bid^$third-party
+||msoiqafieh.com^$third-party
 ||mspaimzv.com^$third-party
+||mspgkbvxtl.com^$third-party
+||mspnlttfp.com^$third-party
 ||msrwoxdkffcl.com^$third-party
+||mstmrspnqqevsu.com^$third-party
 ||msvgmziu.bid^$third-party
+||msxmfyhwgkos.com^$third-party
 ||mszfmpseoqbu.com^$third-party
 ||mtbadedrhcx.bid^$third-party
 ||mtbnqoixmb.com^$third-party
 ||mtbpqzke.bid^$third-party
 ||mtbsdhzpikjt.com^$third-party
+||mtbwqtfqnj.com^$third-party
 ||mtbyuuflne.com^$third-party
+||mtdlcstsqt.com^$third-party
 ||mtfopqsufagxy.com^$third-party
 ||mtklywkg.com^$third-party
 ||mtlieuvyoikf.com^$third-party
 ||mtmzmcztix.com^$third-party
+||mtnobdfcgylhuj.com^$third-party
+||mtnreztslx.com^$third-party
 ||mtnysmosgmp.bid^$third-party
 ||mtpjldykpuhnmg.bid^$third-party
 ||mttyfwtvyumc.com^$third-party
@@ -43255,12 +42404,20 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||mtveughs.com^$third-party
 ||mtyqtczr.bid^$third-party
 ||mtysahmkqqdo.com^$third-party
+||muasoctv.com^$third-party
 ||mueqzsdabscd.com^$third-party
+||mueyqvzw.com^$third-party
+||muhexvakuawzo.com^$third-party
 ||mukxblrkoaaa.com^$third-party
+||mumbldnn.com^$third-party
 ||munpprwlhric.com^$third-party
 ||munqaasewcla.bid^$third-party
+||muoiuxfj.com^$third-party
 ||muoyeoyymfwwp.bid^$third-party
 ||muqyzjkamhpu.bid^$third-party
+||musighkm.com^$third-party
+||muwjxxvovtb.com^$third-party
+||muxtpvixahawy.com^$third-party
 ||mvdbdtwicgw.bid^$third-party
 ||mvddovmyeh.bid^$third-party
 ||mvdnsrgolwgru.com^$third-party
@@ -43270,48 +42427,80 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||mvkmhjlqqjnay.bid^$third-party
 ||mvlcwazi.bid^$third-party
 ||mvncasmaxapgyk.bid^$third-party
+||mvnyllursi.com^$third-party
+||mvotvznetuvfb.com^$third-party
 ||mvqinxgp.com^$third-party
+||mvqzskrnrsy.com^$third-party
 ||mvrmyxkw.com^$third-party
 ||mvtunjij.bid^$third-party
 ||mvumhltl.com^$third-party
+||mvunstblutptj.com^$third-party
 ||mvvecbfomk.com^$third-party
+||mvxhbajzn.com^$third-party
+||mvyctyji.com^$third-party
 ||mvyfuwczzotfe.bid^$third-party
+||mvyutamcykv.com^$third-party
 ||mvzfgknmmkjzx.com^$third-party
 ||mvzmmcbxssgp.com^$third-party
 ||mwbhjpjscy.com^$third-party
 ||mwcouuxv.bid^$third-party
 ||mwenzdgzgez.bid^$third-party
+||mwfzoumik.com^$third-party
 ||mwgairxva.bid^$third-party
+||mwggummxeygq.com^$third-party
 ||mwgjoofxf.bid^$third-party
+||mwhtoxix.com^$third-party
 ||mwlucuvbyrff.com^$third-party
+||mwnhdnkevthkz.com^$third-party
 ||mwqkpxsrlrus.com^$third-party
+||mwuiykzqwaic.com^$third-party
 ||mwxurdlzjbuvh.bid^$third-party
 ||mwztugbv.bid^$third-party
 ||mwzutiypqyyx.com^$third-party
 ||mxctsflkxs.com^$third-party
 ||mxltxnomp.bid^$third-party
+||mxpzslze.com^$third-party
 ||mxqxkljb.bid^$third-party
 ||mxsuikhqaggf.com^$third-party
 ||mxtcafifuufp.com^$third-party
 ||mxvvvoqbgzdq.com^$third-party
 ||mxxrzwibnlnmd.bid^$third-party
+||mxzxeersjv.com^$third-party
 ||myawrthcsjc.com^$third-party
 ||myfebqficpi.com^$third-party
 ||myfrvfxqeimp.com^$third-party
 ||myhdpwmjabpc.bid^$third-party
 ||myjnlndnbhcih.com^$third-party
+||mykhtesikvuz.com^$third-party
 ||mykpenejaaj.bid^$third-party
+||mylhebhwgim.com^$third-party
 ||mylslrkbn.com^$third-party
+||myogwiwjlfrngo.com^$third-party
+||myqnpgfgjo.com^$third-party
+||myqvhpjyd.com^$third-party
+||myzsyljf.com^$third-party
+||mzaugggxs.com^$third-party
 ||mzbetmhucxih.com^$third-party
+||mzgqqjpnbez.com^$third-party
 ||mzguykhxnuap.com^$third-party
+||mzhcaexrrl.com^$third-party
 ||mzhyrgyo.bid^$third-party
+||mzjotkigwu.com^$third-party
 ||mzkhhjueazkn.com^$third-party
 ||mznijqwjkqadk.com^$third-party
 ||mzqxeqrmgzxv.com^$third-party
 ||mzrhjbbikqm.com^$third-party
+||mzwaqcfbx.com^$third-party
+||mzxexigxkb.com^$third-party
+||mzzouiciajems.com^$third-party
 ||naaifqdqsnxtsp.com^$third-party
+||naavxddd.com^$third-party
+||nahixtmnmpcz.com^$third-party
+||nahpewniig.com^$third-party
 ||nahvyfyfpffm.com^$third-party
 ||namjixxurjam.com^$third-party
+||naohofhbprtx.com^$third-party
+||napickmw.com^$third-party
 ||nasfrzhbqvgq.bid^$third-party
 ||naucmjbzmymdzr.bid^$third-party
 ||nawdwtocxqru.com^$third-party
@@ -43323,6 +42512,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||nbfvybpkasjs.com^$third-party
 ||nbhbqvfcsds.com^$third-party
 ||nbhubocsduzn.com^$third-party
+||nbkcuewy.com^$third-party
 ||nbkwnsonadrb.com^$third-party
 ||nbmffortfyyg.com^$third-party
 ||nbnsioedq.com^$third-party
@@ -43331,32 +42521,45 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||nbrmungojjggt.bid^$third-party
 ||nbrokpopimjbw.com^$third-party
 ||nbrwtboukesx.com^$third-party
+||nbrwvrqyz.com^$third-party
 ||nbsmsblzow.com^$third-party
+||nbvbblmksiahf.com^$third-party
+||nbxfvfeanq.com^$third-party
+||nbxpuziszhqz.com^$third-party
+||nbylhvbswplcj.com^$third-party
 ||nbzionsmbgrt.com^$third-party
 ||ncbklawyb.bid^$third-party
 ||ncdxfwxijazn.com^$third-party
 ||nceuiwtnpyuqtn.bid^$third-party
+||nchxvxvy.com^$third-party
 ||ncitwacpa.com^$third-party
 ||ncjjybttngffe.com^$third-party
+||nclfwbnmcrci.com^$third-party
+||ncoibhdzttozh.com^$third-party
 ||ncouqiwjjaot.com^$third-party
 ||ncqlobobtqc.com^$third-party
 ||ncruzwye.com^$third-party
 ||ncsirrabtlant.bid^$third-party
 ||ncspvnslmmbv.com^$third-party
+||ncsyyeabk.com^$third-party
 ||ncwjhywskph.com^$third-party
 ||ndemlviibdyc.com^$third-party
 ||ndgmwuxzxppa.com^$third-party
+||ndilzwjgblea.com^$third-party
 ||ndkvzncsuxgx.com^$third-party
 ||ndndptjtonhh.com^$third-party
 ||ndpegjgxzbbv.com^$third-party
+||ndprxvzgy.com^$third-party
 ||ndpxcdodtjhfv.bid^$third-party
 ||ndqvlall.com^$third-party
 ||ndqwtlseuqjbc.com^$third-party
 ||ndtlcaudedxz.com^$third-party
 ||ndxidnvvyvwx.com^$third-party
+||ndxtyryloc.com^$third-party
 ||neaozrrjd.com^$third-party
 ||neddwrmmced.bid^$third-party
 ||nedmppiilnld.com^$third-party
+||neecnuaa.com^$third-party
 ||neentjsdrgsf.com^$third-party
 ||neevjrhxk.com^$third-party
 ||nefczemmdcqi.com^$third-party
@@ -43368,45 +42571,76 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||nelgpwiezcwynt.bid^$third-party
 ||nemzdfjnyqy.bid^$third-party
 ||neopqlhmnow.bid^$third-party
+||neschaypaxkk.com^$third-party
 ||newnyqfgkkjht.com^$third-party
+||neyenbozrfuocz.com^$third-party
+||nezbumpwtdexd.com^$third-party
 ||nfaqnqsfhih.bid^$third-party
+||nfbjwvmndabthb.com^$third-party
+||nfbpcvzj.com^$third-party
+||nfbpdwso.com^$third-party
 ||nfdntqlqrgwc.com^$third-party
 ||nfefwoasiq.bid^$third-party
+||nfijzdjtpglk.com^$third-party
+||nfkxplkiid.com^$third-party
 ||nfniziqm.com^$third-party
 ||nfnssadfhxov.com^$third-party
+||nfnxvdds.com^$third-party
 ||nfqxehrpahqhjf.com^$third-party
 ||nfqxhapbtenjq.bid^$third-party
+||nfrlqwjwwzri.com^$third-party
 ||nfsqrijauncb.com^$third-party
 ||nftmatxswtow.bid^$third-party
 ||nfuqjjlfqjixo.bid^$third-party
 ||nfxusyviqsnh.com^$third-party
+||nfxzakrvymtuhs.com^$third-party
 ||nfzaustkhtkd.com^$third-party
+||ngfsciiu.com^$third-party
 ||ngkqlfcm.com^$third-party
+||nglrbsnu.com^$third-party
 ||ngmckvucrjbnyybvgesxozxcwpgnaljhpedttelavqmpgvfsxg.com^$third-party
+||ngmhnamtzgzabg.com^$third-party
+||ngmpuognxgs.com^$third-party
 ||ngnofhussaao.com^$third-party
+||ngptxgpbdnutvi.com^$third-party
 ||nguooqblyjrz.com^$third-party
 ||ngxyswkgi.com^$third-party
+||ngymzbpjnqra.com^$third-party
+||nharaeklya.com^$third-party
 ||nhbklvpswckx.com^$third-party
 ||nheanvabodkw.com^$third-party
+||nhkhxvnhfdkn.com^$third-party
+||nhqmomir.com^$third-party
 ||niaqaltky.com^$third-party
+||nicmtzkucd.com^$third-party
 ||nicucircvp.bid^$third-party
 ||nidjppokmlcx.com^$third-party
+||nidksyrrrtckzj.com^$third-party
 ||nifyalnngdhb.com^$third-party
 ||nijksigqjzalcf.com^$third-party
+||nikxhdrys.com^$third-party
+||ninxcwcwgvr.com^$third-party
+||nirqmbrzplvtjr.com^$third-party
 ||niviemwsmiaq.com^$third-party
+||nivsrtqdurhjz.com^$third-party
 ||niydbkjpz.bid^$third-party
 ||njcdmsgjbbbz.com^$third-party
 ||njcmfnnzwwuj.com^$third-party
+||njeozjhyjb.com^$third-party
+||njgogjkwlzroh.com^$third-party
 ||njjdnqhehvlzjd.bid^$third-party
 ||njjybqyiuotl.com^$third-party
 ||njlltkkaavws.com^$third-party
+||njmeadll.com^$third-party
 ||njrpynolojcel.com^$third-party
 ||njswarysemyf.bid^$third-party
 ||njvpulnxjzhhf.bid^$third-party
+||njxjjvyim.com^$third-party
 ||nkbvvlhdnagkd.bid^$third-party
 ||nkclrxanzeossa.com^$third-party
 ||nkcyhqvzmzlnh.bid^$third-party
 ||nkfqetvgeytp.bid^$third-party
+||nkfqzyqmkp.com^$third-party
 ||nkgvtmwdb.com^$third-party
 ||nkhxzhnwr.bid^$third-party
 ||nkjmaymezfhlf.bid^$third-party
@@ -43419,49 +42653,80 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||nklofbjtpfpp.bid^$third-party
 ||nksfmnvmngxzr.bid^$third-party
 ||nkxdyorwbt.com^$third-party
+||nkyafqufx.com^$third-party
 ||nkyngrtleloc.com^$third-party
 ||nlcfowfz.com^$third-party
 ||nlduyricoemfc.bid^$third-party
 ||nlfqbfwbfovt.com^$third-party
 ||nlhayvlqar.bid^$third-party
 ||nlhhrkamvs.bid^$third-party
+||nljpyhzkat.com^$third-party
+||nllbirpx.com^$third-party
 ||nlljrfvbnisi.com^$third-party
 ||nlmzvpvvhsau.bid^$third-party
+||nlnhfsmo.com^$third-party
 ||nlpsxhgmdywaoq.com^$third-party
+||nlqfhpikbrtk.com^$third-party
 ||nlrhavhbkxlsl.bid^$third-party
+||nlteopgkeb.com^$third-party
+||nltzieywjkfb.com^$third-party
+||nlujbqmtgv.com^$third-party
+||nlyqwlyykvjl.com^$third-party
 ||nmaafswoiecv.com^$third-party
 ||nmayxdwzhaus.com^$third-party
+||nmdvagwi.com^$third-party
 ||nmesbjkqkkoy.bid^$third-party
 ||nmfzjbyub.com^$third-party
 ||nmhhnyqmxgku.com^$third-party
+||nmlvcxad.com^$third-party
+||nmnzukxervpdnx.com^$third-party
 ||nmouzlbragpyp.com^$third-party
 ||nmpmgmldzvrmra.com^$third-party
+||nmqgjoytd.com^$third-party
+||nmrcieuvb.com^$third-party
 ||nmtikqygo.com^$third-party
 ||nmuwmfgdwpwb.com^$third-party
+||nmvqhlengcrur.com^$third-party
+||nmwzrcdzbrjj.com^$third-party
 ||nmxpownvqtc.bid^$third-party
+||nmywwgnnkmud.com^$third-party
 ||nmzouxbmqghpb.bid^$third-party
 ||nnakekwkkh.bid^$third-party
 ||nnbestmblotl.com^$third-party
 ||nnbmyxnbyduea.bid^$third-party
+||nndgxdunwvte.com^$third-party
+||nngfrvcf.com^$third-party
 ||nngqyjabfvq.bid^$third-party
 ||nnhuvmftitju.com^$third-party
 ||nnigsvoorscmgnyobwuhrgnbcgtiicyflrtpwxsekldubasizg.com^$third-party
 ||nniiptyximoeus.bid^$third-party
+||nnijfmocgvclcg.com^$third-party
 ||nnioduwnrwpq.bid^$third-party
 ||nnjiluslnwli.com^$third-party
 ||nnjumxsvpjbnb.bid^$third-party
+||nnmgvixuhbqju.com^$third-party
+||nnoxqfmbdv.com^$third-party
+||nnpiggtivf.com^$third-party
 ||nnrcjzith.bid^$third-party
 ||nnrdntrrjf.bid^$third-party
+||nnroeulsnslk.com^$third-party
+||nntvphjayapz.com^$third-party
+||nnulezwhvbrzwu.com^$third-party
 ||nnvjigagpwsh.com^$third-party
+||nnvqabkpa.com^$third-party
 ||nnzkabsgmfjn.bid^$third-party
 ||nnztrsuu.com^$third-party
 ||nobosrekns.bid^$third-party
+||nobpgppgbucy.com^$third-party
 ||nocwsbtdiiufa.bid^$third-party
 ||nodvmmtniokbz.bid^$third-party
+||nofhtrsaz.com^$third-party
 ||nofoxnalt.com^$third-party
 ||nogxucpaktrya.com^$third-party
 ||nohsshsxpv.club^$third-party
+||noiaifyednjt.com^$third-party
 ||nokswnfvghee.com^$third-party
+||nolpjfsu.com^$third-party
 ||nolzqbzxiq.com^$third-party
 ||nomlxyhfgeny.com^$third-party
 ||nomzkqffqsz.com^$third-party
@@ -43472,6 +42737,9 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||notqlzafzch.bid^$third-party
 ||nouusaniebhhfv.bid^$third-party
 ||nouvurtqlz.bid^$third-party
+||novhyaxaioxaon.com^$third-party
+||nowymmrxj.com^$third-party
+||noxredxaijqdb.com^$third-party
 ||npaclqyoqrwh.bid^$third-party
 ||npauffnlpgzw.com^$third-party
 ||npeanaixbjptsemxrcivetuusaagofdeahtrxofqpxoshduhri.com^$third-party
@@ -43480,28 +42748,44 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||nplrzxvyrhiq.com^$third-party
 ||npoxaukym.com^$third-party
 ||nprcpjufz.bid^$third-party
+||npujhntk.com^$third-party
 ||npuwpglke.bid^$third-party
 ||npzlzsxkq.bid^$third-party
 ||nqbhezlm.com^$third-party
+||nqcqwnvazq.com^$third-party
+||nqiabjxpcsea.com^$third-party
 ||nqkttgrapot.bid^$third-party
 ||nqlkwyyzzgtn.com^$third-party
+||nqlrewsfmywgbx.com^$third-party
+||nqmwfddfwogbhw.com^$third-party
 ||nqtxbweqb.com^$third-party
+||nqtyrwyklcmh.com^$third-party
 ||nqugsnsoghz.bid^$third-party
+||nqxdnmsp.com^$third-party
 ||nqxhehxadtswz.bid^$third-party
+||nqzmtrwend.com^$third-party
+||nqzmumesrbiy.com^$third-party
+||nrcrbfqa.com^$third-party
 ||nrectoqhwdhi.com^$third-party
 ||nrepcbiqaasqih.bid^$third-party
 ||nrfltkshqgzowk.bid^$third-party
+||nrgbjgui.com^$third-party
 ||nrgpugas.com^$third-party
 ||nrgqdsjqu.com^$third-party
 ||nrifyiemem.bid^$third-party
+||nrllvmtosawfm.com^$third-party
 ||nrmcznhlqnx.com^$third-party
 ||nrszmiiwfifwlq.bid^$third-party
 ||nrtapaiums.com^$third-party
+||nrubehhd.com^$third-party
 ||nrwofsfancse.bid^$third-party
 ||nryvxfosuiju.com^$third-party
+||nrzhlsvqxbgpbn.com^$third-party
 ||nrzkcztiaum.bid^$third-party
 ||nsazelqlavtc.com^$third-party
+||nsboaqyssquk.com^$third-party
 ||nsbugtfudztsgq.bid^$third-party
+||nscjgmhyeov.com^$third-party
 ||nscjodfvzemwpc.bid^$third-party
 ||nselnhbwlm.com^$third-party
 ||nsfocddqbiilg.bid^$third-party
@@ -43509,6 +42793,8 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||nsnfokcikwf.com^$third-party
 ||nsqdwwwoxs.com^$third-party
 ||nsqitedrzv.bid^$third-party
+||nstjenxcpvm.com^$third-party
+||nswnseld.com^$third-party
 ||ntbftkhrsrh.com^$third-party
 ||ntduattgboduk.com^$third-party
 ||ntejdhcom.bid^$third-party
@@ -43516,31 +42802,55 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||ntetguxoeuvevp.com^$third-party
 ||ntewqfsjum.bid^$third-party
 ||ntfhglciig.bid^$third-party
+||ntgqcnferh.com^$third-party
 ||nthssedj.bid^$third-party
+||nticqzrucdg.com^$third-party
+||ntjcrsfvszoen.com^$third-party
+||ntkuokicthbxc.com^$third-party
+||ntlhrttump.com^$third-party
 ||ntndubuzxyfz.com^$third-party
 ||ntnjaxoov.com^$third-party
 ||ntnlawgchgds.com^$third-party
+||ntnmliatmtk.com^$third-party
+||ntoyqqrwrmzr.com^$third-party
+||ntpawkfea.com^$third-party
+||ntwhbuqmel.com^$third-party
+||nuaycqtaluwha.com^$third-party
 ||nuayfpthqlkq.com^$third-party
 ||nubarwcziykx.bid^$third-party
 ||nubtjnopbjup.com^$third-party
+||nucndowcvrugy.com^$third-party
 ||nucpzlpmp.bid^$third-party
 ||nucqkjkvppgs.com^$third-party
+||nudooapfildwbz.com^$third-party
 ||nuhcibapynaj.bid^$third-party
 ||nuihcvbixjea.com^$third-party
 ||nuilpwatzeuvzp.com^$third-party
+||numcxvlfguc.com^$third-party
 ||nunmnrbjrbsac.com^$third-party
 ||nunsbvlzuhyi.com^$third-party
 ||nuogahntmkid.com^$third-party
+||nuowoczmvits.com^$third-party
+||nupgypwxcv.com^$third-party
 ||nuscutsdqqcc.com^$third-party
 ||nushflxucofk.com^$third-party
+||nutlekuainya.com^$third-party
+||nuxdkxknj.com^$third-party
+||nuxsmhexm.com^$third-party
 ||nvajxoahenwe.com^$third-party
 ||nvcwvcmwdjgjyu.bid^$third-party
+||nvgcmeqfn.com^$third-party
+||nvjjquyylqicp.com^$third-party
 ||nvkkjenz.com^$third-party
 ||nvmjtxnlcdqo.com^$third-party
+||nvnbwkkryjqsvh.com^$third-party
 ||nvnvyikitffcdr.com^$third-party
+||nvoepbzqtn.com^$third-party
 ||nvqsjdvgqnyk.com^$third-party
 ||nvvdtfqboy.bid^$third-party
 ||nvwpybcjpzohoz.bid^$third-party
+||nvztwdkbldp.com^$third-party
+||nwazehtl.com^$third-party
 ||nwcvzkicuo.bid^$third-party
 ||nwdufyamroaf.com^$third-party
 ||nwfdrxktftep.com^$third-party
@@ -43548,25 +42858,45 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||nwirvhxxcsft.com^$third-party
 ||nwkwefhpjohlor.bid^$third-party
 ||nwooatwtmhfdh.bid^$third-party
+||nwqgyaxazz.com^$third-party
 ||nwrgqhjtullyjs.com^$third-party
 ||nwrkyuftlnbzuh.bid^$third-party
+||nwsderzo.com^$third-party
 ||nwwfnpxxdxjjj.bid^$third-party
+||nwwiirgkuqtxwa.com^$third-party
+||nwwuhiukrq.com^$third-party
+||nwxtppuoeycp.com^$third-party
+||nwxwaxhfg.com^$third-party
 ||nwyjcvbazvltas.bid^$third-party
 ||nwzawdquu.bid^$third-party
 ||nwzexkxx.com^$third-party
 ||nxcxithvcoeh.com^$third-party
+||nxewruvxprbd.com^$third-party
+||nxjlnchylgsw.com^$third-party
 ||nxnbbqdh.bid^$third-party
+||nxnjpslufglmvp.com^$third-party
 ||nyaisjsghvj.bid^$third-party
 ||nybpurpgexoe.com^$third-party
 ||nycgwaknv.com^$third-party
+||nychunlnlca.com^$third-party
+||nycnjewyxex.com^$third-party
 ||nyfsjqxopdzvvm.bid^$third-party
+||nyltsyud.com^$third-party
+||nypmjsgpmhd.com^$third-party
 ||nyqogyaflmln.com^$third-party
 ||nyrszeos.bid^$third-party
+||nyskocbhfz.com^$third-party
+||nytqlenw.com^$third-party
 ||nyvdouydkxmaws.bid^$third-party
+||nyvqazwtcwk.com^$third-party
+||nywpxugigwfzb.com^$third-party
+||nywuthdzdacoq.com^$third-party
 ||nyzncfurdrdxfi.com^$third-party
 ||nyzobnpbcwjwfs.com^$third-party
+||nzbbsxujqlhjn.com^$third-party
 ||nzbtvquutdr.com^$third-party
 ||nzcpdaboaayv.com^$third-party
+||nzkjbazl.com^$third-party
 ||nzssjqjv.bid^$third-party
 ||nzvbcznobb.com^$third-party
 ||nzwwrvywcfqmsq.com^$third-party
@@ -43574,57 +42904,91 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||nzxriltfmrpl.com^$third-party
 ||nzyymvidnbvz.bid^$third-party
 ||oaadkiypttok.com^$third-party
+||oabcufwk.com^$third-party
 ||oabmmdjlmfk.bid^$third-party
+||oaibzaqh.com^$third-party
 ||oalicqudnfhf.com^$third-party
+||oamhzvwle.com^$third-party
 ||oamrraft.com^$third-party
+||oansiwcmc.com^$third-party
 ||oaogilidstvm.bid^$third-party
 ||oaqaxjmyuxkpm.com^$third-party
 ||oaqwxxjhwpyxjd.com^$third-party
+||oarqgvtkco.com^$third-party
+||oartozvwzv.com^$third-party
 ||oawleebf.com^$third-party
 ||oaxwtgfhsxod.com^$third-party
 ||oazojnwqtsaj.com^$third-party
 ||oazznjmbchmpdg.com^$third-party
+||obczphph.com^$third-party
+||obdzedcpwxk.com^$third-party
+||obeeifroxtivh.com^$third-party
 ||obhkbdiwl.bid^$third-party
+||obhlfwnatj.com^$third-party
 ||objyhpvxcwg.bid^$third-party
 ||oblbewqykouak.com^$third-party
 ||obnyujeibv.com^$third-party
 ||obodwgqr.bid^$third-party
+||obpzuctfozram.com^$third-party
 ||obqtccxcfjmd.com^$third-party
+||obrayxknu.com^$third-party
 ||obthqxbm.com^$third-party
+||obufquwiwy.com^$third-party
 ||obuuyneuhfwf.com^$third-party
 ||obvbubmzdvom.com^$third-party
+||obwvmzdb.com^$third-party
 ||obxffuwanefrr.bid^$third-party
 ||obxwnnheaixf.com^$third-party
 ||obynjduwh.bid^$third-party
+||obyxqjgwg.com^$third-party
+||ocejkjkopphj.com^$third-party
+||oceuwezutqfcbx.com^$third-party
+||ocfsmefzzarkmo.com^$third-party
 ||ocipbbphfszy.com^$third-party
+||ocixtsnyxxvyaw.com^$third-party
 ||ockorrytznnq.bid^$third-party
 ||ockrsolo.bid^$third-party
 ||ocmvmmwctmto.bid^$third-party
+||ocnjgcedhp.com^$third-party
 ||ocofiyymgfyxx.bid^$third-party
+||ocphuciylacb.com^$third-party
+||ocrwyhamhfpfc.com^$third-party
 ||ocssqhhlku.bid^$third-party
 ||ocydwjnqasrn.com^$third-party
 ||ocyhpouojiss.com^$third-party
 ||oczqdwqnvhzz.bid^$third-party
 ||oczvtbskwbmj.com^$third-party
+||odanetrlgvunth.com^$third-party
 ||oddkqxakmuky.bid^$third-party
+||odezwmru.com^$third-party
 ||odkawksnmbg.bid^$third-party
 ||odkpdbvdzwjsgb.bid^$third-party
 ||odldyhreg.bid^$third-party
+||odlkdyoe.com^$third-party
 ||odlwjmkfmqbuus.bid^$third-party
+||ododtktl.com^$third-party
 ||odomcrqlxulb.com^$third-party
 ||odpjcjreznno.com^$third-party
 ||odplbueosuzw.com^$third-party
 ||odsljzffiixm.com^$third-party
 ||odtcspsrhbko.com^$third-party
+||odukhsymyua.com^$third-party
 ||odwymewlu.com^$third-party
 ||odyoudvaar.bid^$third-party
+||oebdarcqsqcdk.com^$third-party
+||oeevatisopdl.com^$third-party
 ||oehjxqhiasrk.com^$third-party
+||oeidusggzj.com^$third-party
 ||oeoogwkwm.bid^$third-party
+||oeppesfmzlbpa.com^$third-party
+||oertmxfsryji.com^$third-party
 ||oetwplgu.com^$third-party
 ||oewscpwrvoca.com^$third-party
 ||oexupdqy.bid^$third-party
+||oezgivtasc.com^$third-party
 ||ofajzowbwzzi.com^$third-party
 ||ofbqjpaamioq.com^$third-party
+||ofdfinqurwpi.com^$third-party
 ||ofdybheqahjamq.bid^$third-party
 ||ofgapiydisrw.com^$third-party
 ||ofghrodsrqkg.com^$third-party
@@ -43634,46 +42998,69 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||ofmeapowymywx.bid^$third-party
 ||ofmuojegzbxo.com^$third-party
 ||ofpwdoovxs.bid^$third-party
+||ofrducrisy.com^$third-party
+||ofslaskeujwn.com^$third-party
 ||ofswhkkqpfm.com^$third-party
 ||ofuqmgatoli.com^$third-party
+||ofuwwzlao.com^$third-party
 ||ofwwrgelrvx.bid^$third-party
 ||ofwznbbxso.com^$third-party
 ||ogbamfpcfac.bid^$third-party
 ||ogegqayudrypc.bid^$third-party
+||ogisrmbhajhyam.com^$third-party
+||ogjascdgq.com^$third-party
 ||ogkmakmofd.bid^$third-party
 ||ogluyourrvv.com^$third-party
+||ognybevu.com^$third-party
 ||ogonhsbjxrxnv.bid^$third-party
+||ogqclfvaq.com^$third-party
 ||ogqeedybsojr.com^$third-party
+||ogqewglysfc.com^$third-party
 ||oguiftmya.com^$third-party
 ||ogulzxfxrmow.com^$third-party
 ||oguorftbvegb.com^$third-party
+||ogvrdxjcgzst.com^$third-party
+||ogyhsyuhczvjg.com^$third-party
 ||ogzivkwjhrs.com^$third-party
 ||ohecnqpldvuw.com^$third-party
 ||ohjmzsvs.com^$third-party
 ||ohkoexdr.com^$third-party
+||ohleiludieje.info^$third-party
 ||ohlpmbbiw.bid^$third-party
 ||ohmvrqomsitr.com^$third-party
 ||ohnohaijfq.com^$third-party
 ||ohpojzltnt.bid^$third-party
 ||ohprlushvz.com^$third-party
+||ohrdpvkzhzbg.com^$third-party
+||ohrkrzvndwitaa.com^$third-party
+||ohwlwlus.com^$third-party
 ||oiahzjhwpsokt.com^$third-party
 ||oicbwkyjsyxjgj.bid^$third-party
 ||oickwqmwerbnq.bid^$third-party
 ||oieeezzld.com^$third-party
+||oiehcvpxfbnur.com^$third-party
 ||oiffrtkdgoef.com^$third-party
 ||oiftdobow.bid^$third-party
+||oijjptnwrg.com^$third-party
 ||oijvjlfjjb.bid^$third-party
 ||oilfeswka.com^$third-party
+||oimpkumntje.com^$third-party
+||oinqqbzs.com^$third-party
 ||oipsyfnmrwir.com^$third-party
 ||oiramtfxzqfc.com^$third-party
 ||oiuilhjzqvf.bid^$third-party
+||oiumoqzo.com^$third-party
 ||oivhkhvbqjh.bid^$third-party
 ||oixafvoxnmceol.com^$third-party
+||oixisqtlbhygp.com^$third-party
+||ojbevkqot.com^$third-party
 ||ojiffvsutzrx.com^$third-party
 ||ojjsoozoerpt.com^$third-party
 ||ojmkcnuur.com^$third-party
 ||ojmokfvfi.com^$third-party
 ||ojngisbfwwyp.com^$third-party
+||ojntbybxh.com^$third-party
+||ojsfjyekvmyb.com^$third-party
 ||ojsfvukuqxdx.bid^$third-party
 ||ojtcgnyikbtg.bid^$third-party
 ||ojvwpiqnmecd.com^$third-party
@@ -43682,12 +43069,16 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||okakjbtitwh.bid^$third-party
 ||okasfshomqmg.com^$third-party
 ||okbiafbcvoqo.com^$third-party
+||okcklbtuel.com^$third-party
+||okdvodyejd.com^$third-party
+||okffuzmscjboad.com^$third-party
 ||okgfvcourjeb.com^$third-party
 ||okhbdrgv.bid^$third-party
 ||okiaecdkdyut.bid^$third-party
 ||okkytnaadhsqnb.com^$third-party
 ||okmuxdbq.com^$third-party
 ||oknmanswftcd.com^$third-party
+||okoufwmfzujsf.com^$third-party
 ||okswjzifwg.bid^$third-party
 ||oktrgkmj.bid^$third-party
 ||okufysjjwtm.bid^$third-party
@@ -43702,14 +43093,19 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||olcqpdykme.com^$third-party
 ||olctpejrnnfh.com^$third-party
 ||olejgcdzgb.bid^$third-party
+||olgjzpgp.com^$third-party
 ||oljpsldr.bid^$third-party
 ||olkxzkbonvau.bid^$third-party
+||olkzcdihiewe.com^$third-party
 ||olmkmtwet.bid^$third-party
 ||olpcbzhvduha.bid^$third-party
 ||olpvmzxadjwgk.com^$third-party
+||olrznxrgkym.com^$third-party
 ||olthlikechgq.com^$third-party
+||olvqbwxucv.com^$third-party
 ||olwopczjfkng.com^$third-party
 ||olxeziuke.com^$third-party
+||omakfhugexq.com^$third-party
 ||omcozngvtyox.com^$third-party
 ||ompzowzfwwfc.com^$third-party
 ||omqygrfokyxg.com^$third-party
@@ -43723,6 +43119,8 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||onkcjpgmshqx.com^$third-party
 ||onmnkdzpmvxfab.bid^$third-party
 ||onndvfcettwt.com^$third-party
+||onocjgpq.com^$third-party
+||onrlaqhh.com^$third-party
 ||onsujkfgc.bid^$third-party
 ||onuwbarslrii.bid^$third-party
 ||onvhilwrqdgd.com^$third-party
@@ -43732,22 +43130,33 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||ooczhygehw.com^$third-party
 ||ooecgdeq.com^$third-party
 ||oofophdrkjoh.com^$third-party
+||oofpjjtc.com^$third-party
 ||ookdapjylpvq.com^$third-party
+||ookiqhfioldxwj.com^$third-party
 ||oonenbygymsl.com^$third-party
 ||ooqgpbkpmq.bid^$third-party
 ||ooqjqnurblp.com^$third-party
 ||oosdjdhqayjm.com^$third-party
+||ootqfqjhzfrtn.com^$third-party
 ||oouggjayokzx.com^$third-party
 ||oougyykaeipzg.bid^$third-party
+||oounzfsyxiuj.com^$third-party
+||ooutqfslr.com^$third-party
 ||oowivxijrgbrzc.bid^$third-party
 ||ooyhetoodapmrjvffzpmjdqubnpevefsofghrfsvixxcbwtmrj.com^$third-party
+||oozrsmpieq.com^$third-party
 ||opawiftgis.com^$third-party
+||opbneuozwyuvpk.com^$third-party
+||opcyvbwkbiaqyt.com^$third-party
 ||opdfugwvncf.bid^$third-party
 ||opdmxlsdzd.bid^$third-party
 ||opencdb84507.com^$third-party
 ||opencdb84508.com^$third-party
 ||opencdb84509.com^$third-party
+||opflriars.com^$third-party
+||opfrjkmmvqmm.com^$third-party
 ||ophpbseelohv.com^$third-party
+||opjfqjlfdxup.com^$third-party
 ||opknogsela.bid^$third-party
 ||opoefqthl.bid^$third-party
 ||oppcgcqytazs.com^$third-party
@@ -43755,9 +43164,12 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||oqaghvocticy.com^$third-party
 ||oqfoiwjwysbffe.com^$third-party
 ||oqgztgtmcxfcic.com^$third-party
+||oqiatejmfwelas.com^$third-party
 ||oqmjxcqgdghq.com^$third-party
+||oqvjuqnkncom.com^$third-party
 ||oqvzugnitr.com^$third-party
 ||oqxwefyi.bid^$third-party
+||oqziwmemusftg.com^$third-party
 ||orddiltnmmlu.com^$third-party
 ||orgvevacxlinrr.com^$third-party
 ||orgzjdgtjmvzi.bid^$third-party
@@ -43768,6 +43180,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||osanmeijvqh.com^$third-party
 ||osbblnlmwzcr.com^$third-party
 ||osdijxyjdn.bid^$third-party
+||oseqbfjtsdz.com^$third-party
 ||osevrgzpsu.com^$third-party
 ||osewuwcdgfb.bid^$third-party
 ||osfipdgo.bid^$third-party
@@ -43778,12 +43191,18 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||oszelwsbb.bid^$third-party
 ||otarrxci.bid^$third-party
 ||otcqlckpafizv.bid^$third-party
+||otdgnmvw.com^$third-party
 ||otewxlcmkih.com^$third-party
+||otfquqgqvsjof.com^$third-party
+||otoxkqlivsqr.com^$third-party
 ||otpckmnnfm.com^$third-party
 ||otpyldlrygga.com^$third-party
+||otqzpgagsstvth.com^$third-party
 ||otrfmbluvrde.com^$third-party
 ||otrjvabiv.bid^$third-party
+||otruzjgxof.com^$third-party
 ||otusnijhkyihod.com^$third-party
+||otuveoqm.com^$third-party
 ||otxjkjhugtzro.bid^$third-party
 ||otxqautshpb.bid^$third-party
 ||otyammyiovhru.com^$third-party
@@ -43791,23 +43210,34 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||ouannxwziw.bid^$third-party
 ||oubibahphzsz.com^$third-party
 ||oubriojtpnps.com^$third-party
+||oucywciij.com^$third-party
+||ougesqknoehod.com^$third-party
 ||ougfkbyllars.com^$third-party
+||ouhdgmzajfaop.com^$third-party
 ||ouiinryhlvbgq.com^$third-party
 ||oulxdvvpmfcd.com^$third-party
 ||ounaihekw.bid^$third-party
+||ounyrilukncbj.com^$third-party
 ||ouvhowyqhacec.bid^$third-party
 ||ouvtjehb.bid^$third-party
 ||ouytveod.com^$third-party
+||ouzqwetenps.com^$third-party
 ||ovchjqpdh.com^$third-party
+||ovckindyf.com^$third-party
 ||ovcksawwem.com^$third-party
+||ovczxzkfkfbb.com^$third-party
 ||ovfbwavekglf.com^$third-party
+||ovgepsxx.com^$third-party
 ||ovgzbnjj.com^$third-party
 ||ovjlgvapqhmpy.com^$third-party
+||ovkihcbxsbfeo.com^$third-party
+||ovmeaxabvfor.com^$third-party
 ||ovoczhahelca.com^$third-party
 ||ovqsyawrm.com^$third-party
 ||ovrdkhamiljt.com^$third-party
 ||ovvddcpjqndfv.com^$third-party
 ||ovzmelkxgtgf.com^$third-party
+||owcdycko.com^$third-party
 ||owcykhrgovbvhh.bid^$third-party
 ||owdeuzstq.bid^$third-party
 ||owdligzikqqh.bid^$third-party
@@ -43816,6 +43246,8 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||owlmjcogunzx.com^$third-party
 ||owmldgrzsc.bid^$third-party
 ||owodfrquhqui.com^$third-party
+||owoeaicjtds.com^$third-party
+||owqhtqryzggt.com^$third-party
 ||owqipeknkcudyi.bid^$third-party
 ||owqobhxvaack.com^$third-party
 ||owqvhdxlscv.bid^$third-party
@@ -43823,13 +43255,22 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||owwewfaxvpch.com^$third-party
 ||owykrhaic.com^$third-party
 ||oxanehlscsry.com^$third-party
+||oxcpvsxgegd.com^$third-party
+||oxpvwliy.com^$third-party
 ||oxybyiyasgu.bid^$third-party
+||oxzffweyw.com^$third-party
 ||oyaqzikgjw.com^$third-party
+||oybahnktadxjju.com^$third-party
 ||oyiqkjsjmmde.com^$third-party
+||oyiqurfqulhuq.com^$third-party
+||oylqnzunnw.com^$third-party
+||oynmftlgufr.com^$third-party
 ||oyrgxjuvsedi.com^$third-party
 ||oytrrdlrovcn.com^$third-party
 ||oywdlsbwkklw.com^$third-party
 ||oyzsverimywg.com^$third-party
+||oyzypkiodmhmv.com^$third-party
+||ozafaszolf.com^$third-party
 ||ozcletvvphmy.com^$third-party
 ||ozhwenyohtpb.com^$third-party
 ||ozkwhjzmboti.com^$third-party
@@ -43846,36 +43287,54 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||ozwtmmcdglos.com^$third-party
 ||ozyjicurrutehe.bid^$third-party
 ||ozymwqsycimr.com^$third-party
+||paecbeeavmopbl.com^$third-party
+||paegcsvchsdlbj.com^$third-party
 ||pafovocg.bid^$third-party
+||pagaynrbee.com^$third-party
 ||pajmxvlsuxyks.bid^$third-party
 ||palzblimzpdk.com^$third-party
 ||paotmlonx.com^$third-party
 ||paruvaubxwwz.bid^$third-party
+||patlgfvxkto.com^$third-party
 ||patuarioahzaen.bid^$third-party
 ||pawxrbexeylzn.com^$third-party
 ||paxshqxkamhkh.com^$third-party
 ||payrfnvfofeq.com^$third-party
+||paysoxemgjqp.com^$third-party
 ||pazktszqpdsu.bid^$third-party
 ||pbbskmfo.bid^$third-party
 ||pbbutsvpzqza.com^$third-party
 ||pbcyvzvdi.bid^$third-party
 ||pbggemxcuosmhz.bid^$third-party
 ||pbhletstiooizj.com^$third-party
+||pbixcuapo.com^$third-party
 ||pbjnssfvatrhc.com^$third-party
 ||pbnnsras.com^$third-party
+||pbofytmakvye.com^$third-party
+||pbpdgojwzfdc.com^$third-party
 ||pbsmzzxrmu.bid^$third-party
+||pbttxbna.com^$third-party
 ||pbuuadgoktmz.com^$third-party
 ||pbzmmqakvzhm.com^$third-party
+||pcbfhotfyuyg.com^$third-party
+||pcdzsowmktz.com^$third-party
 ||pcebrrqydcox.com^$third-party
 ||pceqybrdyncq.com^$third-party
+||pcfobwzmlts.com^$third-party
+||pchijkkms.com^$third-party
+||pckbizoed.com^$third-party
 ||pckhpollpp.bid^$third-party
+||pcpzhtdvtcqj.com^$third-party
 ||pcqmqyqeswnrd.com^$third-party
 ||pcvdrjvku.bid^$third-party
+||pdapmkivb.com^$third-party
 ||pdbaewqjyvux.com^$third-party
 ||pddvryclt.bid^$third-party
 ||pdgpekso.com^$third-party
 ||pdidbylbwghsr.com^$third-party
 ||pdippmqmrkvn.com^$third-party
+||pdnoucwb.com^$third-party
+||pdoijgyoxcjob.com^$third-party
 ||pdrauqbvdgjut.bid^$third-party
 ||pdrvdmqcdd.com^$third-party
 ||pdtaqyjqwfkarz.bid^$third-party
@@ -43887,185 +43346,289 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||pedbkepupj.bid^$third-party
 ||peewuranpdwo.com^$third-party
 ||peewuvgdcian.com^$third-party
+||pegfkacjwjca.com^$third-party
 ||peggziuzk.bid^$third-party
 ||pehjaplsxbsfhs.bid^$third-party
 ||peivdtctdkfpyf.bid^$third-party
+||pejhnrurllsq.com^$third-party
 ||pejtviwezfzvo.bid^$third-party
 ||pejtxefrrlx.com^$third-party
 ||pemgeccz.com^$third-party
 ||pennzxycrdmw.com^$third-party
 ||peqdwnztlzjp.com^$third-party
+||perfcjlensdl.com^$third-party
+||petsarlaaafru.com^$third-party
+||pewdewgeehc.com^$third-party
+||pewgnvqixnhvij.com^$third-party
 ||peypcjxllo.bid^$third-party
+||peyttlwbznahi.com^$third-party
+||pfdctvdgjw.com^$third-party
 ||pfhgihce.bid^$third-party
 ||pfibgoaqdzbp.com^$third-party
+||pfihfdmwdsjum.com^$third-party
+||pfiuzxey.com^$third-party
 ||pfjwtzlfaivp.com^$third-party
 ||pfltlwftndq.com^$third-party
+||pfmoriuywsl.com^$third-party
+||pfoohjpdbxt.com^$third-party
+||pfpkzjwi.com^$third-party
+||pfvfwielz.com^$third-party
 ||pfvgazngauezhk.com^$third-party
+||pfxcnvjoysztb.com^$third-party
+||pgfxwbgema.com^$third-party
 ||pgkdyhdhul.com^$third-party
+||pgmqzpjoauoknj.com^$third-party
 ||pgndlooirt.com^$third-party
+||pgnjgjiwomgdmn.com^$third-party
+||pgpfdravejq.com^$third-party
+||pgpszwldfpc.com^$third-party
+||pgqpibyycasfvl.com^$third-party
 ||pgubdmshfz.bid^$third-party
 ||pguwtwcougzrc.bid^$third-party
 ||pguxoochezkc.com^$third-party
 ||pgxciwvwcfof.com^$third-party
 ||pgymbgnabv.bid^$third-party
 ||phfknysgvwhnr.bid^$third-party
+||phhigelii.com^$third-party
+||phiambczsg.com^$third-party
+||phiubpdrh.com^$third-party
 ||phlslvetboouo.bid^$third-party
+||phpjtafdqsa.com^$third-party
 ||phqqzdemby.bid^$third-party
+||phragnmpo.com^$third-party
+||phskaieua.com^$third-party
 ||phxwwaznm.club^$third-party
 ||phxwwaznm.clupsvdblzcgnjj.com^$third-party
 ||phyhggbk.com^$third-party
 ||pibizrfgsrkji.bid^$third-party
+||pidbbdxixp.com^$third-party
 ||pifaojvaiofw.com^$third-party
+||pifsistcwycouc.com^$third-party
+||piifwkvdil.com^$third-party
 ||piljbvnykkt.bid^$third-party
+||pimygjumeyrtxe.com^$third-party
+||pingqwlxklbiev.com^$third-party
+||pipiryiqu.com^$third-party
+||piqvuvqc.com^$third-party
+||pismvlkq.com^$third-party
+||pitduougk.com^$third-party
+||piuhqbchk.com^$third-party
 ||piwwplvxvqqi.com^$third-party
 ||pixjqfvlsqvu.com^$third-party
 ||piyzmkcxa.bid^$third-party
+||pjbifjjtir.com^$third-party
+||pjbwsczypwze.com^$third-party
 ||pjeledftjxfnd.com^$third-party
 ||pjffrqroudcp.com^$third-party
 ||pjfgugfnw.bid^$third-party
+||pjhwhxmzefjgn.com^$third-party
+||pjkbojrcraj.com^$third-party
 ||pjlcpzevt.bid^$third-party
 ||pjnkstpiz.com^$third-party
 ||pjnrwznmzguc.com^$third-party
 ||pjnudrgy.com^$third-party
+||pjpgrrkegamhq.com^$third-party
 ||pjrlztgwix.com^$third-party
 ||pjtycinmerhb.com^$third-party
 ||pjydgizqsldqj.bid^$third-party
+||pjyuftrh.com^$third-party
 ||pjyxgemom.bid^$third-party
 ||pjzabhzetdmt.com^$third-party
 ||pkdzrxdn.bid^$third-party
 ||pkfqaxlxh.bid^$third-party
+||pkirdfqe.com^$third-party
+||pkitdifnkz.com^$third-party
 ||pkklpazhqqda.com^$third-party
 ||pkkuouvecratte.bid^$third-party
 ||pkmzxzfazpst.com^$third-party
+||pknzoizczuhjvk.com^$third-party
 ||pkougirndckw.com^$third-party
 ||pkoyiqjjxhsy.com^$third-party
 ||pkqbgjuinhgpizxifssrtqsyxnzjxwozacnxsrxnvkrokysnhb.com^$third-party
+||pkrgwlwhhsie.com^$third-party
 ||pktgargbhjmo.com^$third-party
 ||pkucwwgcnuxzo.bid^$third-party
+||pkvhprfhbtft.com^$third-party
+||pkxquvydrgin.com^$third-party
 ||pkzfmxjlkcxkub.com^$third-party
 ||plcsedkinoul.com^$third-party
 ||plgalhmhkhzy.com^$third-party
 ||plgdhrvzsvxp.com^$third-party
+||plhvzqkkirw.com^$third-party
 ||pllblrapagrvn.com^$third-party
+||pllregftgbgmdi.com^$third-party
 ||pllvsqicx.bid^$third-party
 ||plmuxaeyapbqxszavtsljaqvmlsuuvifznvttuuqfcxcbgqdnn.com^$third-party
 ||plmvsvgyaeyo.bid^$third-party
 ||plmythrza.com^$third-party
 ||plquutxxewil.com^$third-party
 ||plwvwvhudkuv.com^$third-party
+||plxtejszb.com^$third-party
 ||plyftjxmrxrk.com^$third-party
+||plzjcnyxcdl.com^$third-party
 ||pmachrxhrwkd.com^$third-party
+||pmdgwnsgucy.com^$third-party
 ||pmecfluqpkwjg.bid^$third-party
 ||pmgmbpuiblak.com^$third-party
 ||pmiiylss.bid^$third-party
 ||pminnsodv.com^$third-party
 ||pmjnelusn.com^$third-party
+||pmjwztzpuhb.com^$third-party
 ||pmkvqmtjniwtyl.com^$third-party
 ||pmlcuxqbngrl.com^$third-party
+||pmohsibnim.com^$third-party
+||pmoucikneuxcxy.com^$third-party
 ||pmpdqkjio.bid^$third-party
 ||pmpeylkaxooynu.bid^$third-party
 ||pmpgazgz.bid^$third-party
 ||pmwlvixdyts.com^$third-party
 ||pmzktktfanzem.bid^$third-party
 ||pnbdbvgfk.com^$third-party
+||pncbscbuzss.com^$third-party
 ||pndiblukiqdix.bid^$third-party
 ||pnfdunvcgl.bid^$third-party
 ||pnfpithmmrxc.com^$third-party
 ||pnjeolgxsimj.com^$third-party
+||pnkrtgea.com^$third-party
 ||pnmkuqkonlzj.com^$third-party
 ||pnmxoeztls.bid^$third-party
+||pnobsmeio.com^$third-party
 ||pnrqhqixc.com^$third-party
 ||pnunijdm.com^$third-party
 ||pnuwjsilfz.bid^$third-party
 ||pnuymnyhbbuf.com^$third-party
+||pnwhrmyit.com^$third-party
 ||pnzaduoelv.bid^$third-party
+||pnzchguyctrsyb.com^$third-party
 ||poaxupoqbw.com^$third-party
 ||poazvacfzbed.com^$third-party
 ||poewhatnvxydts.com^$third-party
+||pogdlwpmck.com^$third-party
 ||pohguiypgprqr.bid^$third-party
 ||poorybdbh.bid^$third-party
 ||pooxbpxm.com^$third-party
 ||popadscdn.net^$third-party
 ||popzkvfimbox.com^$third-party
 ||poqqvnychl.com^$third-party
+||postrsyk.com^$third-party
 ||potmbbqbaqxwp.com^$third-party
+||povqrvsoljy.com^$third-party
+||poxcldtepiulo.com^$third-party
 ||poxwphidbuedh.com^$third-party
+||ppbvmesssyacij.com^$third-party
 ||ppcpsjihmydhr.com^$third-party
+||ppfpocea.com^$third-party
+||ppgzokht.com^$third-party
+||pphyjqna.com^$third-party
+||ppikspdz.com^$third-party
 ||ppjjbzcxripw.com^$third-party
 ||pppjxzcu.bid^$third-party
+||ppqahjgkui.com^$third-party
 ||ppqfteducvts.com^$third-party
+||pprcfwhlmtagay.com^$third-party
 ||ppskhydfqas.bid^$third-party
 ||pptxpeqqcr.com^$third-party
 ||ppupdbeoth.bid^$third-party
 ||ppuuwencqopa.com^$third-party
 ||ppvjsmuexf.bid^$third-party
+||ppvlukah.com^$third-party
+||ppxoxkdpxtu.com^$third-party
 ||ppxrlfhsouac.com^$third-party
+||ppyneidpwpepu.com^$third-party
 ||ppzfvypsurty.com^$third-party
+||pqajjgjg.com^$third-party
 ||pqcjtsrnx.bid^$third-party
 ||pqdysthxgrpz.com^$third-party
 ||pqgnezcfd.bid^$third-party
+||pqgslqshlj.com^$third-party
 ||pqjdiwqmiem.bid^$third-party
+||pqkorfrurnn.com^$third-party
+||pqlueojjnccebi.com^$third-party
 ||pqncneoumiibc.bid^$third-party
 ||pqowedazx.bid^$third-party
 ||pqoznetbeeza.com^$third-party
 ||pqpcgykgtyrfdh.bid^$third-party
 ||pqrzmcyfgbnn.bid^$third-party
 ||pqsfmcuzmoh.com^$third-party
+||pquuiokltzjpeg.com^$third-party
 ||pqvwtddbpvoq.bid^$third-party
 ||pqwaaocbzrob.com^$third-party
 ||pqwbcpqqiiznu.bid^$third-party
 ||praeicwgzapf.com^$third-party
 ||prcfiopms.bid^$third-party
+||prctxexizzpp.com^$third-party
+||prcymjchczmbjj.com^$third-party
 ||prdrmcwuawjwjl.bid^$third-party
 ||prenvifxzjuo.com^$third-party
+||prfxrfkrvzroz.com^$third-party
 ||prggimadscvm.com^$third-party
+||prgncwamr.com^$third-party
 ||prjywixf.bid^$third-party
 ||prmvrxcn.bid^$third-party
 ||prncfucwvi.bid^$third-party
 ||prnxtmtbbqs.bid^$third-party
 ||prpkhpjxghhn.com^$third-party
 ||prqivgpcjxpp.com^$third-party
+||prrpfmrz.com^$third-party
 ||prsmglob.com^$third-party
 ||prtjzzyfi.com^$third-party
+||prulogzjtyksnh.com^$third-party
 ||prunwxph.bid^$third-party
 ||prwlzpyschwi.com^$third-party
+||ps7894.com^$third-party
 ||psbadfsth.bid^$third-party
+||psborsxlcorxuq.com^$third-party
 ||psdnlprwclz.com^$third-party
 ||psehuhxpqip.bid^$third-party
 ||pserhnmbbwexmbjderezswultfqlamugbqzsmyxwumgqwxuerl.com^$third-party
 ||psgdjmtpvey.com^$third-party
 ||pshcqtizgdlm.com^$third-party
+||pskajrxx.com^$third-party
 ||psmlgjalddqu.com^$third-party
+||psnkrefrfh.com^$third-party
 ||psrbrytujuxv.com^$third-party
 ||psvdblzcgnjj.com^$third-party
 ||pswlvlauz.bid^$third-party
+||pswucdobdvt.com^$third-party
 ||psxnwzksttygfs.com^$third-party
+||psxxbhheqxoy.com^$third-party
 ||psygnjvrd.com^$third-party
+||ptarywzhyzri.com^$third-party
 ||ptblqwjz.com^$third-party
 ||ptgiweiu.com^$third-party
+||ptiniretm.com^$third-party
 ||ptiqsfrnkmmtvtpucwzsaqonmvaprjafeerwlyhabobuvuazun.com^$third-party
+||ptkgzsqf.com^$third-party
 ||ptkwepmv.bid^$third-party
 ||ptlbzqzveii.com^$third-party
 ||ptnaubegfbbtwe.com^$third-party
 ||ptoflpqqqkdk.com^$third-party
 ||ptqaqsagtb.bid^$third-party
 ||ptqwvynkyhcwo.bid^$third-party
+||ptrahwwg.com^$third-party
 ||ptrqrnadg.com^$third-party
 ||ptsdnvgn.bid^$third-party
 ||pttjrlnydgjffv.com^$third-party
 ||pttmqpogyu.bid^$third-party
+||ptvcfltikpdi.com^$third-party
 ||ptvjsyfayezb.com^$third-party
 ||ptwnvihnxvg.bid^$third-party
+||ptxqjyqhscs.com^$third-party
+||ptyezfyxcaeu.com^$third-party
 ||ptzbgvqpwnxg.com^$third-party
+||ptzljkufu.com^$third-party
+||ptzpyhhapyt.com^$third-party
 ||pudptxanhspld.bid^$third-party
 ||pudswlbzob.bid^$third-party
 ||pugfgjvrivfm.bid^$third-party
 ||pugklldkhrfg.com^$third-party
 ||pugpwrqsk.bid^$third-party
+||pukzrlddw.com^$third-party
 ||punfbtrcvfdxl.com^$third-party
 ||punlkhusprgw.com^$third-party
 ||punvqjsvnmubxb.com^$third-party
 ||puogotzrsvtg.com^$third-party
+||pupwgnmakgpnrl.com^$third-party
 ||pusbamejpkxq.com^$third-party
 ||pusharest.com^$third-party
 ||puwzwbdopaeq.bid^$third-party
@@ -44073,44 +43636,75 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||pviztjecuczh.com^$third-party
 ||pvjhglgpil.bid^$third-party
 ||pvoplkodbxra.com^$third-party
+||pvpqgjkgvszq.com^$third-party
 ||pvptwhhkfmog.com^$third-party
 ||pvrybwoqcprogc.bid^$third-party
 ||pvtcntdlcdsb.com^$third-party
+||pvumxwnriy.com^$third-party
+||pvuqahjiburadw.com^$third-party
+||pvxfvqlkclc.com^$third-party
+||pwaqmmquztyne.com^$third-party
 ||pwdmtyzyq.com^$third-party
 ||pwgwqtgpx.com^$third-party
 ||pwhsajbcymb.bid^$third-party
 ||pwizshlkrpyh.com^$third-party
 ||pwjrvoznpsse.bid^$third-party
 ||pwkzakhq.com^$third-party
+||pwlqrkgkk.com^$third-party
+||pwrjjvjtvmr.com^$third-party
 ||pwsdbnngexc.bid^$third-party
 ||pwynoympqwgg.com^$third-party
 ||pwzffpolfs.bid^$third-party
 ||pwzjsujf.bid^$third-party
 ||pxarwmerpavfmomfyjwuuinxaipktnanwlkvbmuldgimposwzm.com^$third-party
 ||pxbugrgwy.com^$third-party
+||pxcveedcuzy.com^$third-party
 ||pxgkuwybzuqz.com^$third-party
+||pxhtltatsxarl.com^$third-party
+||pxiqcfkbxof.com^$third-party
+||pxjmdtryd.com^$third-party
+||pxjttrrk.com^$third-party
 ||pxktkwmrribg.com^$third-party
 ||pxlcadvpqd.com^$third-party
 ||pxlijblevbp.bid^$third-party
+||pxlqyrteuuh.com^$third-party
+||pxphhwnmwuey.com^$third-party
 ||pxpndcfntwb.com^$third-party
+||pxthyfgzm.com^$third-party
 ||pxvnhcdzuozqn.com^$third-party
+||pxzacgmr.com^$third-party
 ||pycvhwxtqhknb.com^$third-party
 ||pydpcqjenhjx.com^$third-party
+||pyfmxzhrnivq.com^$third-party
+||pyhtclpgzbe.com^$third-party
 ||pyjjxogzlzcxii.bid^$third-party
 ||pykexoeeibq.com^$third-party
+||pyllxjfkjhpjbq.com^$third-party
+||pyqwtxicjodcij.com^$third-party
 ||pyscgael.bid^$third-party
+||pyubjvvdsrja.com^$third-party
+||pyzkbxspoon.com^$third-party
+||pzbqocjaphp.com^$third-party
 ||pzcpotzdkfyn.com^$third-party
+||pzfittkdqrrsa.com^$third-party
 ||pzgchrjikhfyueumavkqiccvsdqhdjpljgwhbcobsnjrjfidpq.com^$third-party
+||pzjdrhrlzdli.com^$third-party
 ||pzkpyzgqvofi.com^$third-party
 ||pzkqiwezugsucg.com^$third-party
 ||pznxzeflhuad.com^$third-party
+||pzopzjlhqbkgnp.com^$third-party
 ||pzowsxuko.com^$third-party
 ||pzpdxayohfdc.com^$third-party
+||pzpotdmpv.com^$third-party
 ||pzpwjawqbmei.com^$third-party
+||pzszpntjlz.com^$third-party
+||pzzmqjrp.com^$third-party
 ||qaazzemfo.com^$third-party
 ||qabmhhrfi.bid^$third-party
 ||qadtkdlqlemf.com^$third-party
+||qagnufdwht.com^$third-party
 ||qahajvkyfjpg.com^$third-party
+||qaiqromd.com^$third-party
 ||qairctxn.com^$third-party
 ||qajaohrcbpkd.com^$third-party
 ||qajjyxsifzfe.com^$third-party
@@ -44120,6 +43714,7 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||qatuwjyyc.com^$third-party
 ||qavqnwwlxh.bid^$third-party
 ||qawaqcurthru.com^$third-party
+||qaxtgbdxjpibc.com^$third-party
 ||qazzzxwynmot.com^$third-party
 ||qbahsvxo.com^$third-party
 ||qbalehgc.com^$third-party
@@ -44127,15 +43722,24 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||qbfibmzxaqtfi.com^$third-party
 ||qbfvwovkuewm.com^$third-party
 ||qbhcfxxivcdfm.com^$third-party
+||qbjnwjtbfrxceq.com^$third-party
+||qbldzsktv.com^$third-party
 ||qblpxxcjusgmq.bid^$third-party
 ||qblttqtvn.bid^$third-party
 ||qbpawthj.com^$third-party
 ||qbpuavqlsu.com^$third-party
+||qbsanzpkfj.com^$third-party
 ||qbsiawmlm.bid^$third-party
 ||qbsrhrhnybwox.com^$third-party
+||qbtfmtuixtmep.com^$third-party
+||qbttelbrupkss.com^$third-party
 ||qbvwcrtsyur.bid^$third-party
+||qbwjddqa.com^$third-party
 ||qbywtukryaqpp.bid^$third-party
 ||qbyzytmymz.bid^$third-party
+||qcaejiouuvgk.com^$third-party
+||qceixjlqe.com^$third-party
+||qcexplnqbrral.com^$third-party
 ||qcjphhqwl.com^$third-party
 ||qclnagolz.com^$third-party
 ||qclxheddcepf.com^$third-party
@@ -44145,24 +43749,35 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||qcpegxszbgjm.com^$third-party
 ||qcpexkxxyx.bid^$third-party
 ||qcrvwgsfz.com^$third-party
+||qcsjgzxqcyhv.com^$third-party
 ||qctltbnn.com^$third-party
 ||qcxhpohiwawnmo.bid^$third-party
 ||qcyqimny.com^$third-party
+||qczvjjdbaj.com^$third-party
 ||qdajmhpwzdmaji.com^$third-party
 ||qdcoqejn.com^$third-party
 ||qddgbaux.com^$third-party
 ||qddviluvoq.com^$third-party
+||qdgpsfmg.com^$third-party
+||qdjnwlrjllti.com^$third-party
+||qdksdycvbv.com^$third-party
 ||qdlhprdtwhvgxuzklovisrdbkhptpfarrbcmtrxbzlvhygqisv.com^$third-party
 ||qdmpxonl.com^$third-party
 ||qdpbtrwvmioo.bid^$third-party
+||qdpxpnmh.com^$third-party
 ||qdqhseenooz.bid^$third-party
+||qduijsyonrmfke.com^$third-party
+||qdykmiarpuph.com^$third-party
 ||qdzhsgwj.bid^$third-party
 ||qedgufui.bid^$third-party
 ||qeembhyfvjtq.com^$third-party
 ||qefjdsfny.bid^$third-party
+||qefyaspzyhcb.com^$third-party
 ||qegndwekwc.com^$third-party
 ||qekmxaimxkok.com^$third-party
 ||qenafbvgmoci.com^$third-party
+||qenprsuoashu.com^$third-party
+||qeobhjit.com^$third-party
 ||qeqsibev.com^$third-party
 ||qerlbvqwsqtb.com^$third-party
 ||qerlrppx.com^$third-party
@@ -44170,9 +43785,14 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||qevfmwciyp.bid^$third-party
 ||qevivcixnngf.com^$third-party
 ||qevkdmgcv.bid^$third-party
+||qevmzohvwxesrd.com^$third-party
 ||qevqecdfqwp.bid^$third-party
 ||qexegqtytk.bid^$third-party
 ||qexnxaczl.bid^$third-party
+||qezcdxxskinzi.com^$third-party
+||qfcsljgckvpz.com^$third-party
+||qfedsccxccfzut.com^$third-party
+||qfeorrrf.com^$third-party
 ||qfgcmddmwrrkmj.bid^$third-party
 ||qfhjthejwvgm.com^$third-party
 ||qfijmgalopofbj.com^$third-party
@@ -44181,11 +43801,22 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||qfmbgvgvauvt.com^$third-party
 ||qfmcpclzunze.com^$third-party
 ||qfmkufzloxy.bid^$third-party
+||qfpqfdbjyjmvv.com^$third-party
+||qfpqmxkiwh.com^$third-party
 ||qfqihvhm.bid^$third-party
 ||qfqseouk.bid^$third-party
+||qfqtufbrfdpbw.com^$third-party
 ||qfrhhvbfofbt.com^$third-party
 ||qfrpehkvqtyj.com^$third-party
+||qfsutura.com^$third-party
+||qfubwupddefjw.com^$third-party
+||qfypbqbumu.com^$third-party
 ||qfzhppwfkenbmv.bid^$third-party
+||qgawivqfotfyrw.com^$third-party
+||qgbjchbl.com^$third-party
+||qgcliwoxgdptz.com^$third-party
+||qgdqujzzs.com^$third-party
+||qgeglsnoxk.com^$third-party
 ||qgevavwyafjf.com^$third-party
 ||qgggccolqyi.bid^$third-party
 ||qghirkrh.bid^$third-party
@@ -44193,20 +43824,31 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||qgiumuzmxj.com^$third-party
 ||qgjllgijf.bid^$third-party
 ||qgmrchjuqro.bid^$third-party
+||qgnakeddgtdw.com^$third-party
+||qgpmtdrm.com^$third-party
 ||qgraprebabxo.com^$third-party
 ||qgrycwxbn.com^$third-party
+||qgslgwfxar.com^$third-party
 ||qgtbxtex.com^$third-party
 ||qguirbzulwmdm.bid^$third-party
+||qgwazwmlx.com^$third-party
+||qgxrmkbzpm.com^$third-party
 ||qhaavcekkhckzi.com^$third-party
 ||qhdjyxcggzkm.com^$third-party
 ||qhiupkza.bid^$third-party
 ||qhkfgjoyinllld.com^$third-party
 ||qhlwqzntlwvbf.bid^$third-party
 ||qhlzkkwb.com^$third-party
+||qhpjexftk.com^$third-party
+||qhpwanmnbvkiio.com^$third-party
+||qhpwqremdlclpk.com^$third-party
 ||qhqofqeivtno.com^$third-party
+||qhqrtjgsnu.com^$third-party
 ||qhrdwjummidz.bid^$third-party
 ||qhtttixovmuszx.bid^$third-party
+||qhuktypo.com^$third-party
 ||qhxpdoipj.com^$third-party
+||qhzvvwblzrjc.com^$third-party
 ||qicggmagur.com^$third-party
 ||qidkcvmr.com^$third-party
 ||qidtjujkejbaal.bid^$third-party
@@ -44214,8 +43856,11 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||qijffgqsbkii.com^$third-party
 ||qiktwikahncl.com^$third-party
 ||qinsmmxvacuh.com^$third-party
+||qinytcise.com^$third-party
 ||qiqrguvdhcux.com^$third-party
 ||qiremmtynkae.com^$third-party
+||qirkwipiamqsi.com^$third-party
+||qirnhdcywjnd.com^$third-party
 ||qitumxisyt.com^$third-party
 ||qiurgfxexsmp.com^$third-party
 ||qixlpaaeaspr.com^$third-party
@@ -44224,25 +43869,42 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||qjaunokfxqi.bid^$third-party
 ||qjawhmlgsosg.bid^$third-party
 ||qjdgrcupkaqvqe.bid^$third-party
+||qjgqelsvt.com^$third-party
 ||qjgrrysppkqrbl.bid^$third-party
+||qjlgyiuesk.com^$third-party
 ||qjmearsroiyn.com^$third-party
+||qjmkidiwbndolx.com^$third-party
 ||qjmrqglqxlodj.bid^$third-party
 ||qjobvxqp.com^$third-party
 ||qjoqfapllsbtw.bid^$third-party
 ||qjpxalhvenbt.com^$third-party
 ||qjskosdsxanp.com^$third-party
+||qjttowndvet.com^$third-party
+||qjuzjpkihvya.com^$third-party
+||qjvullwjz.com^$third-party
+||qjvzbfym.com^$third-party
 ||qjwanedlhedm.com^$third-party
+||qjwkyhlxa.com^$third-party
 ||qkarmotdhhgeuy.com^$third-party
 ||qkdywnhtmpgc.com^$third-party
 ||qkfhfuua.com^$third-party
 ||qkfqyqczawyb.com^$third-party
 ||qkjltxihv.com^$third-party
 ||qklhtphiphni.com^$third-party
+||qklkjqllykqost.com^$third-party
+||qkmvpyujof.com^$third-party
+||qknfsqxxm.com^$third-party
 ||qknuubmfneib.com^$third-party
 ||qkpwdakgxynv.com^$third-party
+||qksihowyv.com^$third-party
 ||qkuprxbmkeqp.com^$third-party
+||qkwbygfsbfmj.com^$third-party
+||qkyzjwhyeh.com^$third-party
+||qlatsfeyg.com^$third-party
 ||qlgeofwhy.bid^$third-party
 ||qljczwei.com^$third-party
+||qlmgmgvmiepsb.com^$third-party
+||qlmygsvk.com^$third-party
 ||qlqscuseoyrdv.com^$third-party
 ||qlqvzzcaxto.com^$third-party
 ||qlugrmjsncbe.com^$third-party
@@ -44250,13 +43912,22 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||qlvgvehwzj.com^$third-party
 ||qlvtfnfxwcq.bid^$third-party
 ||qlwtdkiuvwpqt.com^$third-party
+||qlxwtwasgmdf.com^$third-party
+||qlyfjtkl.com^$third-party
 ||qmamdjtoykgl.com^$third-party
+||qmiiqzfk.com^$third-party
 ||qmisgnkw.bid^$third-party
 ||qmjjvpoqhb.com^$third-party
+||qmmdvzsebi.com^$third-party
 ||qmotkiltrim.com^$third-party
+||qmouzhzz.com^$third-party
+||qmxpttxjv.com^$third-party
 ||qndqwtrwguhv.com^$third-party
 ||qnfarzjp.bid^$third-party
+||qnfpskgtzkw.com^$third-party
+||qnhwhedcrzeodd.com^$third-party
 ||qnieefmaaqi.bid^$third-party
+||qnjdtefk.com^$third-party
 ||qnjxxbvgfgz.bid^$third-party
 ||qnpolbme.com^$third-party
 ||qnqrmqwehcpa.com^$third-party
@@ -44265,50 +43936,79 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||qnssgaxxcpvwro.bid^$third-party
 ||qnugsbuo.com^$third-party
 ||qnvdwezdshagls.bid^$third-party
+||qnzelsgj.com^$third-party
 ||qnzztgwd.bid^$third-party
 ||qoapuppy.com^$third-party
+||qoayrejue.com^$third-party
 ||qoeplhvlr.bid^$third-party
+||qofzhmbqa.com^$third-party
 ||qogsjvkaoe.com^$third-party
 ||qohoikvwwj.com^$third-party
+||qoiagrfbmquek.com^$third-party
 ||qoiowocphgjm.com^$third-party
 ||qolnnepubuyz.com^$third-party
+||qolrlwwirf.com^$third-party
+||qopqudzeaywc.com^$third-party
+||qosrridifvsr.com^$third-party
 ||qotuhsvlqlpnfd.com^$third-party
 ||qotwtnckqrke.com^$third-party
+||qouiruhpxoa.com^$third-party
 ||qovfvxbl.bid^$third-party
+||qowmqduocv.com^$third-party
 ||qoxalhnndufp.bid^$third-party
+||qoxcijqqkyeob.com^$third-party
 ||qoxsriddwmqx.com^$third-party
+||qoyagwzholjofg.com^$third-party
+||qpbaammdcwu.com^$third-party
 ||qpcyafunjtir.com^$third-party
+||qpeczlqvv.com^$third-party
+||qpganepbkw.com^$third-party
 ||qpiyjprptazz.com^$third-party
 ||qpjowolqlpg.com^$third-party
 ||qpjrrhbfglrly.com^$third-party
+||qpkyqrafgsacm.com^$third-party
+||qplcqdbiob.com^$third-party
 ||qpljfpwdpk.com^$third-party
+||qpmswrurt.com^$third-party
 ||qpodgrwu.bid^$third-party
 ||qpppobrqizen.com^$third-party
+||qpqnbnsnosdss.com^$third-party
+||qpshvivbqpz.com^$third-party
 ||qpttmgdofkkya.bid^$third-party
+||qqablora.com^$third-party
 ||qqapezviufsh.com^$third-party
 ||qqbwymba.com^$third-party
 ||qqbyfhlctzty.com^$third-party
+||qqcbzxwzpmzdcd.com^$third-party
+||qqcjvbsd.com^$third-party
 ||qqdnhrkjtmv.bid^$third-party
 ||qqfrciwnc.bid^$third-party
 ||qqgtevtjnpwd.com^$third-party
+||qqkxrlzaaul.com^$third-party
 ||qqoncxkrkc.bid^$third-party
 ||qqrkutrsg.com^$third-party
 ||qqrwncvoig.bid^$third-party
+||qqtqicbvrwg.com^$third-party
 ||qquncjiru.bid^$third-party
+||qquwjmmgtmle.com^$third-party
 ||qqvatwaqtzgp.com^$third-party
 ||qqylzyrqnewl.com^$third-party
 ||qqztmozc.bid^$third-party
 ||qrcsppwzjryh.com^$third-party
+||qrecxvdoewmztq.com^$third-party
 ||qregqtqtuisj.com^$third-party
 ||qriasmotw.bid^$third-party
+||qrirkdzdxtxc.com^$third-party
 ||qrjvglpkpl.bid^$third-party
 ||qrkiykgbk.com^$third-party
 ||qrklxapy.bid^$third-party
 ||qrksjrjppkam.com^$third-party
+||qrlmvqlxh.com^$third-party
 ||qrocxwig.bid^$third-party
 ||qrozsnmc.com^$third-party
 ||qrpbogawdr.bid^$third-party
 ||qrqmchbp.bid^$third-party
+||qrwlerqenp.com^$third-party
 ||qryllyykezxh.bid^$third-party
 ||qryuumwmiupy.com^$third-party
 ||qrzcenqja.bid^$third-party
@@ -44316,90 +44016,151 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||qscefywopqfkm.com^$third-party
 ||qsdqpvkuglq.com^$third-party
 ||qsfckfyv.com^$third-party
+||qsfogpmciyl.com^$third-party
 ||qsgiqllpfthg.com^$third-party
 ||qsgsfnixw.com^$third-party
 ||qshsaocjet.com^$third-party
 ||qsknevegg.bid^$third-party
+||qsnzncerqgack.com^$third-party
+||qsoetgedlgyhyz.com^$third-party
 ||qsrekvpnu.bid^$third-party
 ||qstwmmuukimz.bid^$third-party
 ||qsxggbsthsk.bid^$third-party
+||qtahsbgdqbu.com^$third-party
 ||qtavukgrtgk.com^$third-party
+||qtbvatpkwxq.com^$third-party
 ||qtczaglj.bid^$third-party
 ||qteoslcm.bid^$third-party
+||qtgarolvaigptk.com^$third-party
 ||qtjafpcpmcri.com^$third-party
+||qtjxalkllc.com^$third-party
 ||qtkluwmebrtbrt.com^$third-party
 ||qtsmzrnccnwz.com^$third-party
+||qtsyxyakun.com^$third-party
 ||qttmjwno.com^$third-party
+||qtuckpvttvikd.com^$third-party
 ||qtvnesozf.com^$third-party
+||qtwadryxicx.com^$third-party
+||qtxihhkvln.com^$third-party
 ||qtywrdgxid.com^$third-party
 ||qtzjozseyxskxw.bid^$third-party
 ||quaizzywzluk.com^$third-party
+||quazhzeih.com^$third-party
 ||quckoemdypxoiq.bid^$third-party
 ||qudpdpkxffzt.com^$third-party
 ||qufyihvx.com^$third-party
 ||qugqgrtyccrlq.bid^$third-party
+||quhlryzpyyion.com^$third-party
 ||quhpkwtljkvedc.com^$third-party
+||qukqptxilr.com^$third-party
 ||qulsqiqrev.com^$third-party
 ||qumzxkpexf.com^$third-party
+||qunnvfhdgfm.com^$third-party
+||qupiinlyjuf.com^$third-party
 ||qupycbhfvqtj.bid^$third-party
 ||quqyiobevrc.com^$third-party
+||qurhdjkms.com^$third-party
+||quyxxofx.com^$third-party
 ||qveoxhidesgy.bid^$third-party
 ||qveuxmbhbhmg.com^$third-party
+||qvgjqhfnbdeur.com^$third-party
+||qvilmdus.com^$third-party
+||qvivzreleolawc.com^$third-party
 ||qvovzakydfvi.bid^$third-party
 ||qvqqvistxqvy.bid^$third-party
 ||qvrfxlskqr.com^$third-party
 ||qvsbroqoaggw.com^$third-party
 ||qvsogqqd.com^$third-party
+||qvsshkcr.com^$third-party
 ||qvxgghoisvifyu.bid^$third-party
 ||qwbnzilogwdc.com^$third-party
 ||qweewmtey.com^$third-party
 ||qwfwimquecfw.bid^$third-party
 ||qwgafzaujn.bid^$third-party
 ||qwhkndqqxxbq.com^$third-party
+||qwittqgogiip.com^$third-party
+||qwlckbrwxizg.com^$third-party
 ||qwqqliynxufj.com^$third-party
 ||qwrkigqtgygc.com^$third-party
 ||qwtuviguywtza.bid^$third-party
+||qwuejlmct.com^$third-party
+||qwuexgqmua.com^$third-party
 ||qwufihkhgxphq.com^$third-party
+||qwuxwxdr.com^$third-party
 ||qwvktoqxqum.bid^$third-party
+||qwyzzghouu.com^$third-party
+||qwzhaqtbiygid.com^$third-party
+||qxamtnrwxjyy.com^$third-party
 ||qxbnmdjmymqa.com^$third-party
+||qxboqjnmxv.com^$third-party
+||qxcibgzsxegxc.com^$third-party
 ||qxdmmuwiz.bid^$third-party
 ||qxekuavasuzgfc.com^$third-party
 ||qxfzgftkfgukkp.com^$third-party
 ||qxgoedqwr.bid^$third-party
+||qxmecqgzrgdh.com^$third-party
 ||qxnniyuuaxhv.com^$third-party
+||qxphrauujms.com^$third-party
 ||qxqtejyqkypfz.bid^$third-party
 ||qxvnvbkcm.com^$third-party
 ||qxxyzmukttyp.com^$third-party
+||qxykytqzwagqj.com^$third-party
+||qybzvfvqzpmxpu.com^$third-party
 ||qycxhqkddcc.com^$third-party
 ||qydpcilzljej.bid^$third-party
+||qydylxmzlnqw.com^$third-party
+||qydzycrxlkdlin.com^$third-party
+||qyfunsvmtudozq.com^$third-party
 ||qyghwcrjaw.bid^$third-party
+||qyifxakawscsyd.com^$third-party
+||qyiiudex.com^$third-party
+||qyillxuyjdlmh.com^$third-party
 ||qykxbnflqvjxvk.com^$third-party
 ||qynohttywcws.bid^$third-party
+||qyqbslpprlph.com^$third-party
+||qyqvfjvbzosz.com^$third-party
+||qyrzcsoaey.com^$third-party
 ||qysextrlhpoc.bid^$third-party
+||qytabshszekf.com^$third-party
+||qytuwxcozbk.com^$third-party
 ||qyvebeos.com^$third-party
 ||qyvpgddwqynp.com^$third-party
+||qywpsotvagapji.com^$third-party
 ||qyzoejyqbqyd.com^$third-party
+||qzaahtgpnb.com^$third-party
 ||qzadueyzyto.bid^$third-party
 ||qzayyghs.bid^$third-party
+||qzbnokxxvvpwf.com^$third-party
 ||qzcpotzdkfyn.com^$third-party
+||qzfnuwdc.com^$third-party
+||qzhaqsxb.com^$third-party
+||qzismxssqf.com^$third-party
+||qzizjjyvsa.com^$third-party
 ||qzpxhebrm.com^$third-party
 ||qzpzspna.bid^$third-party
 ||qzwhzahnieipgz.com^$third-party
 ||qzxtbsnaebfw.com^$third-party
+||rabjkklvegagrn.com^$third-party
 ||radbtqjfp.bid^$third-party
 ||rafvxnikmn.bid^$third-party
 ||rafymfnvvzqlp.com^$third-party
 ||ragbsvbvndovac.com^$third-party
+||rahvoujjgmtvft.com^$third-party
 ||raiybbvwefbcji.bid^$third-party
 ||ralyqgglrbgrd.bid^$third-party
 ||raossycpodtr.bid^$third-party
+||raqucjjblu.com^$third-party
 ||raqueocznwden.bid^$third-party
 ||rascnezpxpe.com^$third-party
 ||raspiadkwcecz.com^$third-party
 ||rawybznxrp.bid^$third-party
+||raxlextehqhw.com^$third-party
 ||rbayzoamcrdg.com^$third-party
+||rbbesmzvokpste.com^$third-party
 ||rbbkqlnnmus.bid^$third-party
 ||rbdmtydtobai.com^$third-party
+||rbefggthfx.com^$third-party
+||rbfgsoanxw.com^$third-party
 ||rbfxurlfctsz.com^$third-party
 ||rbgrlqsepeds.com^$third-party
 ||rbhhjxsomzq.com^$third-party
@@ -44407,12 +44168,16 @@ coingamez.com,mangaumaru.com,milfzr.com,pencurimovie.cc#@#div[id^="div-gpt-ad"]
 ||rbmijhdvh.com^$third-party
 ||rbmjeyiyazcpe.com^$third-party
 ||rbnicxyh.bid^$third-party
+||rbnjngtbpwbk.com^$third-party
 ||rbnpljzf.bid^$third-party
 ||rbppnzuxoatx.com^$third-party
 ||rbrbvedkazkr.com^$third-party
 ||rbrnmvfiambn.bid^$third-party
+||rbrpamcygqplm.com^$third-party
 ||rbrxrcikro.com^$third-party
 ||rbsfglbipyfs.com^$third-party
+||rbtpsbtzh.com^$third-party
+||rbtqofrkiixz.com^$third-party
 ||rbuowrinsjsx.com^$third-party
 ||rbvfibdsouqz.com^$third-party
 ||rbyjirwjbibz.com^$third-party
@@